ESTScan Details for Unigene SGN-U271796

Score 
299
Direction 
Forward
Predicted Peptide Sequence 
MWIATVWIDSIFLNLAKDLQAEEHVVVVIQTKKLQLFSKVGGVIGWAVSLLNLPRVAGXGQNGPVHEAQNPDDEERAEVSDLPTFREFTV
EQLRISTSGFAVENIVSEHGEKAPNVVYKGKLENQRRVAVKRFNRSAWPDSRQFLEEX
Predicted Coding Sequence 
ATGTGGATAGCAACTGTTTGGATTGACTCAATCTTTTTGAATCTTGCTAAAGATCTTCAAGCTGAAGAACATGTGGTGGTTGTGATACAA
ACAAAAAAGTTGCAGTTATTCTCTAAAGTAGGCGGGGTAATAGGATGGGCTGTGAGTCTTCTAAACTTGCCTCGTGTTGCTGGAGXTGGA
CAGAATGGTCCTGTTCATGAGGCTCAGAATCCTGATGATGAAGAAAGAGCTGAAGTTAGTGATTTGCCTACGTTCCGCGAGTTTACTGTT
GAGCAGCTGAGAATATCTACTTCTGGATTTGCTGTAGAGAATATAGTTTCAGAACATGGTGAAAAAGCTCCTAATGTTGTTTATAAAGGA
AAGTTAGAGAACCAGAGGAGAGTTGCTGTCAAACGCTTTAATAGATCTGCATGGCCTGATTCCCGACAGTTCTTAGAAGAAGXX\
Edits in Original Sequence 
GAGAACTAGTCTCGAGTTTTATTTTTTTCCTTTTTCTCTCTTCACATCTCTCTCTCTATCCTCTTTACTATATATATATATGCTCTACTT
CACCTGACTCCATTTTCACTTTCTTGATCTCTCTCAAGAAATTAATCTGCTGCACTTTTTTGAATCAATCAATCTTCAAGAAAGGGTGGT
TTGGAATTGGTGTGTGTTGATTCAGTTGGAAAAGGGGAGCTTTTTGGTTCTTGATTGGATTTGGGGAGAAAGTTTGTGGCTTTGGGATTC
ATTCGTT
(5')ATGTGGATAGCAACTGTTTGGATTGACTCAATCTTTTTGAATCTaTGCTAAAGATCTTCtAAGCTGAAGAACATGTGGT
GGTTGTGATACAAACAAAAAAGTTGCAGTTATaTCTCTAAAGTAGGCGGGGTAATAGGATGGGCTGTGAGTCTTCTAAACTTGCCTCGTG
TTGCTGGAGXTGGACAGAATGGTCCTGTTCATGAGGCTCAGAATCCTGATGATGAAGAAAGAGCTGAAGTTAGTGATTTGCCTACGTTCC
GCGAGTTTACTGTTGAGCAGCTGAGAATATCTACTTCTGGATTTGCTGTAGAGAATATAGTTTCAGAACATGGTGAAAAAGCTCCTAATG
TTGTTTATAAAGGAAAGTTAGAGAACCAGAGGAGAGTTGCTGTCAAACGCTTTAATAGATCTGCATGGCCTGATTCCCGACAGTTCTTAG
AAGAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan