ESTScan Details for Unigene SGN-U271797

Score 
630
Direction 
Forward
Predicted Peptide Sequence 
MGCESSKLASCCWTGESGPIHEAQNPDEEKNEVSDSPAFCEFTFEQLRIATSAFAVENIVSEHGEKAPNVVYKGKLENQRPVAVKRFNRS
AWPDSRQFLEEARAVGLLRNNRLANLLGCCCEGDERLLVAEFMPKETLAKHLFHWDTQPMKWAMRLRVALYIAQALEYCTGKGRALYHDL
NAYRILFGEDGDPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRITPESVIFSFGTLLIDLLSGX
Predicted Coding Sequence 
ATGGGCTGTGAAAGTTCTAAACTTGCCTCGTGTTGCTGGACTGGAGAGAGTGGCCCCATTCATGAGGCTCAGAATCCTGATGAGGAAAAA
AATGAAGTTAGTGATTCACCTGCATTCTGCGAGTTTACATTTGAGCAGCTGAGGATTGCTACATCTGCATTTGCTGTAGAGAATATAGTT
TCTGAACATGGTGAAAAAGCTCCAAATGTTGTTTATAAAGGAAAGCTAGAGAACCAGAGGCCGGTTGCTGTTAAACGCTTCAACAGATCT
GCATGGCCTGATTCCCGGCAATTTTTAGAAGAAGCAAGGGCTGTTGGTCTACTCCGCAACAATAGGTTAGCAAATCTTCTTGGCTGTTGT
TGTGAGGGTGATGAGAGGTTGCTAGTTGCAGAATTCATGCCCAAAGAGACGCTTGCAAAACATCTTTTTCATTGGGACACACAACCAATG
AAGTGGGCAATGCGGTTAAGGGTGGCATTGTATATTGCACAGGCTCTTGAATATTGTACAGGCAAAGGACGTGCTCTTTATCATGATCTT
AATGCTTATAGAATATTATTCGGAGAAGATGGTGATCCCCGACTCTCTTGCTTTGGTTTGATGAAGAACAGTCGAGATGGAAAAAGTTAC
AGCACAAACTTGGCATTTACTCCTCCTGAATATTTGAGGACAGGTAGAATCACCCCAGAGAGTGTGATATTTAGCTTTGGGACACTTTTG
ATTGACCTTCTCAGTGGAAAX\
Edits in Original Sequence 
ATCTGTACAATCACATTTTTCATTCCATCTCATCTACTCTGTAATTGTTTATATGTATATTCTCACTTTCTACTAACTCCTTTCTCTTTC
TTCTCCACTTTATTGATCTTTTGTGTCTACAGTTAATTTAAACAAAGAATCACGAATTTACTCCACTGTCAGCAGAAGCTGTTATTTGGA
AAAAGTTCGTGTTTTGGAATTTATTACGTGGATTTTCAGTTCGCTCAGCTTTGATATGTTAATAAAGCCAAATGCAGATCTTAAAGCCGC
ATAAAGTGTAATTTGTCGGGTTGTGCTATAAACTCCAAGCTACTATATCTTTAAAGACTTTAAATCTGTTGGATAGTGTG
(5')ATGGGC
TGTGAAAGTTCTAAACTTGCCTCGTGTTGCTGGACTGGAGAGAGTGGCCCCATTCATGAGGCTCAGAATCCTGATGAGGAAAAAAATGAA
GTTAGTGATTCACCTGCATTCTGCGAGTTTACATTTGAGCAGCTGAGGATTGCTACATCTGCATTTGCTGTAGAGAATATAGTTTCTGAA
CATGGTGAAAAAGCTCCAAATGTTGTTTATAAAGGAAAGCTAGAGAACCAGAGGCCGGTTGCTGTTAAACGCTTCAACAGATCTGCATGG
CCTGATTCCCGGCAATTTTTAGAAGAAGCAAGGGCTGTTGGTCTACTCCGCAACAATAGGTTAGCAAATCTTCTTGGCTGTTGTTGTGAG
GGTGATGAGAGGTTGCTAGTTGCAGAATTCATGCCCAAAGAGACGCTTGCAAAACATCTTTTTCATTGGGACACACAACCAATGAAGTGG
GCAATGCGGTTAAGGGTGGCATTGTATATTGCACAGGCTCTTGAATATTGTACAGGCAAAGGACGTGCTCTTTATCATGATCTTAATGCT
TATAGAATATTATTCGGAGAAGATGGTGATCCCCGACTCTCTTGCTTTGGTTTGATGAAGAACAGTCGAGATGGAAAAAGTTACAGCACA
AACTTGGCATTTACTCCTCCTGAATATTTGAGGACAGGTAGAATCACCCCAGAGAGTGTGATATTTAGCTTTGGGACACTTTTGATTGAC
CTTCTCAGTGGAAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan