ESTScan Details for Unigene SGN-U271829

Score 
444
Direction 
Forward
Predicted Peptide Sequence 
DNGGDEKKAKEGDNDKKEKESGGGGGKGGDKKGKGDIEKKDAELKVASSGGEVVNKMEYYGYNANTFYAMPMQHHGYMNGATMYDHGYGH
TGYVVEYGHQPQYVPPPPPPTYLNAPQMFSDENPNGCFIMXKNDQAVTIFIHEFXKSLVYEVEDLDDYLILFASHEAYSFK
Predicted Coding Sequence 
XXAGACAATGGAGGAGATGAAAAGAAAGCCAAGGAAGGTGACAATGACAAGAAGGAGAAAGAGAGCGGTGGTGGTGGTGGCAAAGGCGGA
GACAAGAAAGGAAAAGGCGATATAGAGAAAAAAGACGCTGAACTCAAGGTGGCTAGTAGTGGAGGTGAGGTCGTTAACAAAATGGAATAC
TATGGTTATAATGCAAATACATTTTACGCGATGCCTATGCAACATCATGGCTATATGAATGGCGCCACAATGTATGATCATGGTTATGGT
CATACAGGCTACGTAGTCGAGTATGGCCACCAGCCACAATATGTGCCACCACCTCCTCCACCAACGTACTTGAATGCACCTCAAATGTTC
AGTGATGAAAATCCTAATGGTTGTTTCATCATGXTGAAAAATGATCAAGCXGTAACAATATTCATACATGAATTTCXGAAGAGTCTTGTC
TATGAAGTAGAGGACCTCGATGACTACCTCATTTTATTTGCTTCGCACGAAGCGTATAGCTTTAAGTAA\
Edits in Original Sequence 
(5')XXAGACAATGGAGGAGATGAAAAGAAAGCCAAGGAAGGTGACAATGACAAGAAGGAGAAAGAGAGCGGTGGTGGTGGTGGCAAAGG
CGGAGACAAGAAAGGAAAAGGCGATATAGAGAAAAAAGACGCTGAAtCTCAAGGTGGCTAGTAGTGGAGGTGAGGTCGTTAACAAAATGG
AATACTATGGTTATAATGCAAATACATTTTACGCGATGCCTATGCAACATCATGGCTATATGAATGGCGCCACAATGTATGATCATGGTT
ATGGTCATACAGGCTACGTAGTCGAGTATGGCCACCAGCCACAATATGTGCCACCACCTCCTCCACCAACGTACTTGAATGCACCTCAAA
TGTTCAGTGATGAAAATCCTAATGGTTGTTTCATCATGXTGAAAAATGATCAAGCXGTAACAATATTCATACATGAATTTCXGAAGAGTC
TTGTCTATGAAGTAGAGcGACCTCGATGACTACCTCATTTTATTTGCTTCGCACGAAGCGTATAGCTTTAAGTAA\(3')TAGGAATTTT
TGGTTCAGCTAAATTGTACAATATCTAATATATTAAAGCTGAAAAATAGATGCATATGAAAGCTTATATATGAGGATAGACTGTAGAGTG
ACGTCTTAGGAAATTTTATTAGCTAATTAGTGAAAAAGGGCTAAATCACCATCTAGTGGTAGATTAATCCGTATTTATTTATTTTTTTGT
TCGAATTTTATGTCATTTTTTGTTTGTAGCTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan