ESTScan Details for Unigene SGN-U271831

Score 
608
Direction 
Forward
Predicted Peptide Sequence 
AETPSVPAPTGSDPDYWCYQCETRVAVETLPDLPADVICSNCKSGFVESIPSRVVSVSPVTASTDQIDDPAFGNQFIQVLRLIAEAARDN
EGPPPPPSEHADPTDDDDDDDDDVDDVDEDEEVENRDDDEEDLQRRRRDVLRLRLRDFAARAANXAKPDSGLGRDFDGTGRPLYXSSRFQ
VPDGDGYIGNPGDYVDAAGYEALLQTLAESDGSGRRGAPPASKSAIEGLNTLVIKEEQEVMACAICKDVVNVGEMAKNLPCGHGYHDDCI
VXVVGFEEFLSSLRFELPTDDPEYEEERKKRGACVTSSGSSSSSEAPGAAAADDDDDSSPSCL
Predicted Coding Sequence 
GCCGAGACCCCTTCAGTCCCTGCACCAACCGGGTCGGATCCTGATTACTGGTGCTACCAGTGTGAGACACGGGTTGCCGTCGAAACCCTA
CCCGATCTCCCCGCCGATGTCATTTGCAGCAACTGTAAGAGTGGCTTCGTCGAGTCCATACCCTCTCGTGTTGTTTCTGTCTCTCCGGTG
ACGGCGTCTACTGATCAGATCGATGACCCTGCTTTCGGCAATCAGTTCATCCAGGTTCTTCGCCTCATAGCTGAAGCGGCGCGTGACAAC
GAGGGGCCCCCTCCCCCGCCTTCTGAGCACGCTGATCCTACCGATGACGACGATGATGATGATGATGATGTTGATGATGTTGATGAGGAT
GAAGAAGTTGAGAATCGGGATGATGATGAAGAGGACCTTCAGAGAAGGAGGAGGGATGTGCTACGTCTCCGGCTACGTGACTTCGCCGCC
AGAGCTGCCAATXCGGCGAAACCGGATTCTGGATTGGGCAGAGATTTTGATGGGACTGGAAGACCACTCTATXTGAGCTCCCGATTTCAA
GTTCCTGATGGCGATGGCTACATCGGGAACCCTGGAGACTATGTGGACGCAGCGGGTTATGAAGCTTTACTGCAAACCCTAGCCGAGAGT
GATGGTAGCGGAAGACGAGGAGCTCCACCAGCTTCCAAGAGTGCAATTGAGGGTCTCAATACATTGGTGATCAAGGAAGAGCAGGAGGTA
ATGGCATGTGCCATTTGTAAAGATGTAGTGAATGTGGGCGAAATGGCAAAGAATTTACCCTGTGGGCATGGTTACCATGATGATTGTATA
GTTXCAGTGGTTGGGTTCGAGGAATTCTTGTCCAGTCTGAGGTTTGAATTGCCCACAGATGATCCTGAATATGAAGAGGAGCGCAAGAAG
CGAGGAGCATGTGTTACTAGCAGTGGTTCTTCGAGCTCAAGTGAGGCGCCAGGTGCTGCTGCTGCTGATGATGATGATGATAGTAGTCCT
AGTTGCCTTTGA\
Edits in Original Sequence 
(5')GCCGAGACCCCTTCAGTCCCTGCACCAACCGGGTCGGATCCTGATTACTGGTGCTACCAGTGTGAGACACGGGTTGCCGTCGAAAC
CCTACCCGATCTCCCCGCCGATGTCATTTGCAGCAACTGTAAGAGTGGCTTCGTCGAGTCCATACCCTCTCGTGTTGTTTCTGTCTCTCC
GGTGACGGCGTCTACTGATCAGATCGATGACCCTGCTTTCGGCAATCAGTTCATCCAGGTTCTTCGCCTCATAGCTGAAGCGGCGCGTGA
CAACGAGGGGCCCCCTCCCCCGCCTTCTGAGCACGCTGATCCTACCGATGACGACGATGATGATGATGATGATGTTGATGATGTTGATGA
GGATGAAGAAGTTGAGAATCGGGATGATGATGAAGAGGACCTTCAGAGAAGGAGGAGGGATGTGCTACGTCTCCGGCTACGTGACTTCGC
CGCCAGAGCTGCCAATXCGGCGAAACCGGATTCTGGATTGGGCAGAGATTTTGATGGGACTGGAAGACCACTCTATXTGAGCTCCCGATT
TCAAGTTCCTGATGGCGATGGCTACATCGGGAACCCTGGAGACTATGTGGACGCAGCGGGTTATGAAGCTTTACTGCAAACCCTAGCCGA
GAGTGATGGTAGCGGAAGACGAGGAGCTCCACCAGCTTCCAAGAGTGCAATTGAGGGTCTCAATACATTGGTGATCAAGGAAGAGCAGGA
GGTAATGGCATGTGCCATTTGTAAAGATGTAGTGAATGTGGGCGAAATGGCAAAGAATTTACCCTGTGGGCATGGTTACCATGATGATTG
TATAGTTXCAGTGGTTGGGTTCGAGGAATTCTTGTCCAGTCTGtAGGTTTGAATTGCCCACAGATGATCCTGAATATGAAGAGGAGCGCA
AGAAGCGAGGAGCATGTGTTACTAGCAGTGGTTCTTCGAGCTCAAGTGAGGCGCCAGGTGCTGCTGCTGCTGATGATGATGATGATAGTA
GTCCTAGTTGCCTTTGA\(3')TTGCTGCATTGTGGTAAACTCAGCCATTGGCATTCTTTTTAGCTTGGTCTCTTGCTTCTTTTTTGGTA
TTTGGTGATTGTTTTCCAGTGTAATTCCACCCTCTCCTCTTTTCTTGAATGTAATAATCTGTTTATCTTAATGCTGGTATGAATTTGCCA
TTTGAGTACTTATGAATCCTACATATTATACATACTAAATTACTTCTTTTAGACAAAAAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan