ESTScan Details for Unigene SGN-U271854

Score 
587
Direction 
Forward
Predicted Peptide Sequence 
MASVFSLPSSSFLCPLKTTRFRTKFQSLHSSPKPFLINSLQLKELDPNIPEPVQTFWKWLCDEGVVSAKTPVKPGIVPEGLGLVAKRDIA
KGETVLEVPRRFWINPDAVADTEIGNVCTGLKPWISVALFLLREKWRDDSKWKYYMAVLPESTDSTIYWSEEELSEIQGTQLLSTTLSVK
DYVQNEFQKVX
Predicted Coding Sequence 
ATGGCTTCTGTTTTCTCTTTACCCTCTTCATCTTTCCTCTGTCCACTCAAAACCACAAGATTCAGAACAAAGTTTCAATCTTTACACAGT
TCCCCAAAACCATTCTTGATAAACTCACTTCAGTTAAAAGAACTTGACCCAAATATCCCAGAACCAGTCCAAACATTCTGGAAGTGGCTA
TGTGATGAAGGGGTTGTATCAGCAAAGACACCTGTAAAGCCAGGAATTGTACCAGAAGGTTTAGGATTAGTTGCTAAGAGAGATATAGCT
AAAGGGGAGACAGTTCTAGAAGTTCCTAGAAGGTTCTGGATTAATCCAGATGCAGTTGCAGATACTGAAATTGGGAATGTGTGTACTGGA
TTGAAACCTTGGATTTCTGTTGCTCTTTTCTTGCTTAGAGAGAAATGGAGAGATGATTCAAAGTGGAAATATTACATGGCTGTTCTTCCA
GAGTCTACTGATTCCACTATATATTGGTCTGAAGAGGAGCTTTCTGAGATTCAAGGGACTCAACTTTTAAGCACAACATTGAGTGTGAAA
GATTATGTGCAAAATGAATTTCAAAAAGTGGAX\
Edits in Original Sequence 
CTGGAAATCTAGTTACTCTGAAATCCAGTAGAACCAAACCAAGCTAGCTAAGAGGGAAACAAAGCTAGAACAA(5')ATGGCTTCTGTTT
TCTCTTTACCCTCTTCATCTTTCCTCTGTCCACTCAAAACCACAAGATTCAGAACAAAGTTTCAATCTTTACACAGTTCCCCAAAACCAT
TCTTGATAAACTCACTTCAGTTAAAAGAACTTGACCCAAATATCCCAGAACCAGTCCAAACATTCTGGAAGTGGCTATGTGATGAAGGGG
TTGTATCAGCAAAGACACCTGTAAAGCCAGGAATTGTACCAGAAGGTTTAGGATTAGTTGCTAAGAGAGATATAGCTAAAGGGGAGACAG
TTCTAGAAGTTCCTAGAAGGTTCTGGATTAATCCAGATGCAGTTGCAGATACTGAAATTGGGAATGTGTGTACTGGATTGAAACCTTGGA
TTTCTGTTGCTCTTTTCTTGCTTAGAGAGAAATGGAGAGATGATTCAAAGTGGAAATATTACATGGCTGTTCTTCCAGAGTCTACTGATT
CCACTATATATTGGTCTGAAGAGGAGCTTTCTGAGATTCAAGGGACTCAACTTTTAAGCACAACATTGAGTGTGAAAGATTATGTGCAAA
ATGAATTTCAAAAAGTGGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan