ESTScan Details for Unigene SGN-U271859

Score 
504
Direction 
Forward
Predicted Peptide Sequence 
TLKTFYTLSTENPNSFLHEEXDHNLIDFTEKREYPKVSFQKLKQKKGKKSALMEVTVKENEFVVLSISEVSSSSSTSFSKSEPVFARFGS
GSGAPELRFGQESQSGADIVIVLRASQLFRLGSAESLCISEVFEDNKETGYSRGISIQFKNEEESRAFHCAFEQWKTEMVVQGSPLPNGA
VSTSTSKFDEKIEASSAKMYFHYYGXLLHQQNMLQDFVRTGTYYAAVIENRADFLX
Predicted Coding Sequence 
XTCACACTCAAGACCTTCTACACACTCTCTACTGAAAACCCTAATTCATTTCTCCATGAAGAAXCAGATCATAATTTGATTGATTTCACT
GAGAAGAGAGAATATCCGAAGGTTTCGTTTCAGAAATTGAAGCAAAAAAAAGGAAAAAAATCAGCGTTAATGGAGGTTACTGTGAAGGAA
AACGAATTTGTGGTTTTATCGATTTCGGAGGTTTCATCTTCTTCATCTACTTCGTTTTCTAAATCGGAACCGGTTTTTGCTCGGTTTGGT
TCGGGTTCTGGAGCTCCGGAGCTCCGATTTGGACAGGAGTCTCAATCCGGTGCCGACATTGTGATCGTTCTTCGAGCTTCGCAGTTATTC
AGGCTAGGATCTGCAGAATCTCTGTGCATATCTGAAGTTTTTGAAGACAATAAGGAGACAGGCTATTCCAGAGGAATCTCCATTCAATTT
AAAAACGAGGAGGAAAGTAGGGCCTTCCATTGTGCATTTGAGCAATGGAAGACAGAAATGGTTGTTCAAGGGTCTCCTCTGCCAAATGGA
GCAGTATCAACTTCAACAAGTAAATTCGATGAAAAAATAGAGGCATCTTCTGCTAAAATGTATTTTCACTACTATGGANCACTATTGCAT
CAACAAAATATGCTGCAGGATTTTGTAAGGACAGGAACCTATTATGCTGCTGTAATTGAGAACCGTGCTGATTTTCTTGXX\
Edits in Original Sequence 
(5')XTCACACTCAAGACCTTCTACACACTCTCTACTGAAAACCCTAATTCATTTCTCCATGAAGAAXCAGATCATAATTTGATTGATTT
CACTGAGAAGAGAGAATATCCGAAGGTTTCGTTTCAGAAATTGAAGCAAAAAAAAGGAAAAAAATCAGCGTTAATGGAGGTTACTGTGAA
GGAAAACGAATTTGTGGTTTTATCGATTTCGGAGGTTTCATCTTCTTCATCTACTTCGTTTTCTAAATCGGAACCGGTTTTTGCTCGGTT
TGGTTCGGGTTCTGGAGCTCCGGAGCTCCGATTTGGACAGGAGTCTCAATCCGGTGCCGACATTGTGATCGTTCTTCGAGCTTCGCAGTT
ATTCAGGCTAGGATCTGCAGAATCTCTGTGCATATCTGAAGTTTTTGAAGACAATAAGGAGACAGGCTATTCCAGAGGAATCTCCATTCA
ATTTAAAAACGAGGAGGAAAGTAGGGCCTTCCATTGTGCATTTGAGCAATGGAAGACAGAAATGGTTGTTCAAGGGTCTCCTCTGCCAAA
TGGAGCAGTATCAACTTCAACAAGTAAATTCGATGAAAAAATAGAGGCATCTTCTGCTAAAATGTATTTTCACTACTATGGANCACTATT
GCATCAACAAAATATGCTGCAGGATTTTGTAAGGACAGGAACCTATTATGCTGCTGTAATTGAGAACCGTGCTGATTTTCTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan