Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U271864

Score 
232
Direction 
Forward
Predicted Peptide Sequence 
GSLRVHSKLNNNVIEITESKSFYELLGIQETVSLLEIKQAYKQLARKYHPDVSPPGRVEENTQRFIRVQEAYETLSDPKSRDMYDKDMSK
GLHFAFSPRRKCQNDESMEDTGEWKNRWHSQLSELKRRNTHKDSGNNMSWGARMRRQRNETSL
Predicted Coding Sequence 
GGGTCTTTGAGAGTTCATTCAAAACTTAACAACAATGTGATAGAAATTACTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAA
ACTGTTTCTTTATTAGAAATCAAACAAGCGTATAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAA
AATACCCAAAGGTTTATTCGGGTTCAAGAAGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGATAAAGATATGTCTAAA
GGTCTTCACTTTGCATTCTCTCCTCGTAGAAAGTGCCAAAATGATGAGTCGATGGAGGACACTGGTGAATGGAAGAATCGTTGGCATTCC
CAGCTATCCGAGTTGAAAAGAAGAAACACACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACGTATGCGTAGGCAAAGGAATGAA
ACATCGTTATAA\
Edits in Original Sequence 
AAAAAAAAATGTATCTAAGAACCCCAATAGATCGTGTACTATTTTCCCCATCATATCCACAATTTTCAAGAACTCAAAAA(5')GGGTCT
TTGAGAGTTCATTCAAAACTTAACAACAATGTGATAGAAATTACTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAAACTGTT
TCTTTATTAGAAATCAAACAAGCGTATAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAAAATACC
CAAAGGTTTATTCGGGTTCAAGAAGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGATAAAGATATGTCTAAAGGTCTT
CACTTTGCATTCTCTCCTCGTAGAAAGTGCCAAAATGATGAGTCGATGGAGGACACTGGTGAATGGAAGAATCGTTGGCATTCCCAGCTA
TCCGAGTTGAAAAGAAGAAACACACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACGTATGCGTAGGCAAAGGAATGAAACATCG
TTATAA\(3')TGAATAATCCTTGTTATATAGTTTTTATATATTGCGTGTATATTAGATATATAATTGGAAGTGTTTGGTTAGCATTGAT
GTTATAAGTAGTGTAACAACTTGTGTAAGTGCTAACCAAATATAGGTAACTGTTTGTACAGAGTTATTTGTGAATCAAGTTGCTATTTTA
ACGAGAAATACACATGCTGAGAGACTAGTAAAAAAATGGAGAGATTTATTATTAGAGTTAATATTGTGGTAGTTATTATTATTTGTTATG
GCAATTCAAAAGTTAGAGATATGCATCGAGATGGTGAAAATGGCAATAGAGATTGTAGCCATGTTTGTAGATGCAGTGGGCACTATTGTC
TCTAAAGATAATAAGTATTCTTCATCATCAACACAATCCAATATTGATCTTCCAACGCCCTATGTTGGTTTCTAACATATGGATTAATCA
CATAGTCCATTCAATTTTGTTTTGGGATCGAGACATAATTATTGTTAACTTTTTTTTTTAACTTTTTAACTTAATTGTTTTTAGATGCAA
TAGTTGGTATATGGGAGATTAAGTTTTGGTAGTCCTTGAGATCTCCGTTGTAAACTATATAAGATAATTTCTTGTTAAGTTAACGAAATT
CAACACATATTGCGTTAGACATCTTGTGTTCTTCGATTTGTTGTTGTTATTGTTCGAATTCATTTATAAAAAAAGGAAGCTAATTAGTGT
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan