ESTScan Details for Unigene SGN-U271945

Score 
774
Direction 
Forward
Predicted Peptide Sequence 
VEVNFGAQPKLKTLDYFFLQAKQQQLAGKYVRLEVRXLKEPVTEPXQPFLDTDNGEELMHVQPGTAVVLGSRPPESPGTLYITSKQVVWL
SDTDRSKGYAVDFLSVSLHAVSRDPEAYRDPCLYAQIDNGVEDDESEGSSDEGDVSSDLSRITELRLVPSDPNQVDTLFQIFCDCAELNP
EPIEEEEEHNWIFSADQLENQEAEEDSEWMISPNSTHPIGRSNGDHDLAHNVLQLQINDQRFEDAEEMDSDTKNGQTIPSQDYLKVCQPG
GAFLISDSEFLVLLADLDEQSFCENDXEFYTGTSSFIMSQIVIHD
Predicted Coding Sequence 
GTCGAAGTTAATTTTGGCGCCCAACCTAAACTXAAAACCCTAGACTACTTTTTTTTGCAAGCTAAGCAACAGCAATTAGCCGGAAAATAT
GTCAGGCTTGAAGTTCGTCXGCTGAAAGAACCGGTGACGGAGCCGGXGCAGCCATTCCTGGACACCGACAACGGCGAGGAACTCATGCAT
GTTCAGCCTGGAACTGCTGTAGTCCTCGGCAGCCGCCCTCCTGAGTCACCTGGCACTCTCTATATCACCTCCAAGCAAGTGGTGTGGCTA
AGCGATACTGATAGGAGTAAAGGTTATGCAGTTGATTTCTTGTCTGTTTCACTTCATGCGGTCTCTAGAGACCCCGAGGCTTATCGGGAT
CCTTGTTTATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGTTCCAGTGATGAAGGTGATGTGTCATCAGATTTATCA
AGGATCACTGAGTTGAGACTTGTGCCATCAGATCCTAATCAAGTGGATACTCTCTTCCAGATCTTTTGTGATTGTGCTGAGCTTAATCCT
GAACCAATTGAAGAGGAGGAGGAACATAATTGGATCTTCAGCGCAGATCAGCTGGAAAATCAGGAAGCTGAAGAAGATTCTGAATGGATG
ATTTCTCCAAACTCTACACATCCAATTGGTCGTTCAAATGGGGATCACGACTTAGCTCATAATGTACTTCAGCTTCAGATTAATGATCAA
AGGTTTGAAGATGCGGAGGAAATGGACAGTGACACCAAAAATGGCCAAACCATTCCTAGTCAAGATTACCTTAAAGTGTGTCAACCTGGT
GGAGCTTTTCTCATTTCAGATTCAGAGTTTCTTGTGCTACTTGCTGATTTGGATGAACAGAGTTTTTGCGAAAATGATTAXGAATTCTAT
ACAGGAACTAGTAGTTTTATTATGTCACAAATAGTGATCCATGATTAA\
Edits in Original Sequence 
(5')GTCGAAGTTAATTTTGGCGCCCAACCTAAACTXAAAACCCTAGACTACTTTTTTTTGCtAAGCTAAGCAACAGCAATTAGCCGGAA
AATATGTCAGGCTTGAAGTTCGTCXGCTGAAAGAACCGGTGACGGAGCCGGXGCAGCCATTCCTGGACACCGACAACGGCGAGGAACTCA
TGCATGTTCAGCCTGGAACTGCTGTAGTCCTCGGCAGCCGCCCTCCTGAGTCACCTGGCACTCTCTATATCACCTCCAAGCAAGTGGTGT
GGCTAAGCGATACTGATAGGAGTAAAGGTTATGCAGTTGATTTCTTGTCTGTTTCACTTCATGCGGTCTCTAGAGACCCCGAGGCTTATC
GGGATCCTTGTTTATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGTTCCAGTGATGAAGGTGATGTGTCATCAGATT
TATCAAGGATCACTGAGTTGAGACTTGTGCCATCAGATCCTAATCAAGTGGATACTCTCTTCCAGATCTTTTGTGATTGTGCTGAGCTTA
ATCCTGAACCAATTGAAGAGGAGGAGGAACATAATTGGATCTTCAGCGCAGATCAGCTGGAAAATCAGGAAGCTGAAGAAGATTCTGAAT
GGATGATTTCTCCAAACTCTACACATCCAATTGGTCGTTCAAATGGGGATCACGACTTAGCTCATAATGTACTTCAGCTTCAGATTAATG
ATCAAAGGTTTGAAGATGCGGAGGAAATGGACAGTGACACCAAAAATGGCCAtAACCATTCCTAGTCAAGATTACCTTAAAGTGTGTCAA
CCTGGTGGAGCTTTTCTCATTTCAGATTCAGAGTTTCTTGTGCTACTTGCTGATTTGGATGAACAGAGTTTTTGCGAAAATGATTAXGAA
TTCTATACAGGAACTAGTAGTTTTATTATGTCACAAATAGTGATCCATGATTAA\(3')TGCGAGCTGAGATGATATAGCTCAGTTGTAG
GTACCTTCCCTTGGTTTTTTTCCTGTATTGTGCTGTTCCTTCTGTTTATAACCTGAGTTATGATGACCTTAAGGTTTCTGGGGATACTTG
CTTGTACACATAAATTTGGTTAAACATTTCGGTATCTTGCCCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan