ESTScan Details for Unigene SGN-U272089

Score 
861
Direction 
Forward
Predicted Peptide Sequence 
PTIGDGAKNIDPLVRAHTYYRALPSRSALVSPYTVTKMTVTDLLGVTQNANSSEIKKAYYKLSLKHHPDKNPDPESKKLFVKIANAYEIL
KNEATREQYDYALAHPEEFFYNTARYYHAYYGHKTDTRAVLVGLLLIVSIFQYLNQWTRYNQAIDMVKKTPAYKNKLRALELQRTGGMAN
RKKGNKPMDKKVEEELGKELNLDIKGTEKPAVWDLIGIRFILLPYTLGKLLLWYGCWFWRYNVKRAPYTWEDASYLTRRSLRASLDSWIS
IDESTKEDLIERRLWEKSNFESYVAEMRKESKPEDKSSFVFTQSYMCSMRSVLMGSILSHEAXKSNVKLLKKQNSFDKESYWIDKYVIEL
GFSRQCHSYISTQNNKYTKNILRQIQAYCIWSNFGGQASSDDAAPHGDFAVVMLG
Predicted Coding Sequence 
XCGCCGACGATCGGAGATGGCGCGAAGAATATCGATCCACTGGTTCGCGCTCACACTTACTATCGTGCTCTCCCTTCTCGTTCAGCXCTT
GTTTCTCCATATACTGTGACGAAGATGACTGTTACXGATCTCCTTGGGGTTACTCAAAATGCCAATTCTTCTGAAATCAAGAAAGCTTAT
TACAAGCTCTCTCTAAAACATCATCCAGATAAAAACCCTGATCCAGAATCAAAGAAGCTTTTTGTGAAAATTGCAAATGCGTATGAGATT
TTGAAAAACGAAGCCACAAGGGAGCAGTATGATTATGCACTTGCCCATCCAGAGGAGTTTTTCTACAATACAGCACGGTATTACCATGCT
TACTATGGTCACAAAACTGATACCCGTGCTGTGCTCGTTGGTCTTCTTTTGATAGTCTCAATATTTCAGTATCTGAATCAGTGGACAAGA
TATAATCAGGCTATTGACATGGTCAAGAAAACACCAGCTTATAAAAACAAGCTACGTGCTTTGGAGCTTCAACGCACTGGAGGAATGGCT
AATAGGAAGAAGGGCAACAAGCCGATGGACAAGAAGGTGGAAGAAGAACTTGGCAAGGAACTCAACTTGGACATAAAGGGCACTGAAAAG
CCTGCTGTTTGGGATCTAATTGGAATTCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTATTGTGGTATGGGTGTTGGTTCTGG
AGGTACAATGTCAAGCGTGCTCCATACACATGGGAAGATGCCTCCTATTTGACACGAAGGTCCCTTCGGGCTTCTCTTGATTCATGGATA
TCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTATGTGGCAGAGATGCGCAAG
GAATCAAAGCCCGAAGATAAAAGTTCTTTTGTTTTTACTCAAAGCTATATGTGTAGTATGAGATCAGTTTTGATGGGGAGTATTCTGAGT
CATGAAGCCGAXAAGTCTAATGTTAAATTATTGAAGAAGCAAAATTCTTTTGACAAGGAGAGCTATTGGATTGATAAGTATGTCATAGAA
CTTGGATTTTCACGGCAGTGTCATAGCTATATTAGTACTCAAAATAATAAGTATACAAAAAACATATTGAGACAGATACAAGCATACTGC
ATTTGGAGCAATTTTGGGGGACAAGCTTCTTCTGATGATGCTGCTCCCCACGGTGATTTTGCTGTTGTAATGCTAGGTTAG\
Edits in Original Sequence 
(5')XCGCCGACGATCGGAGATGGCGCGAAGAATATCGATCCACTGGTTCGCGCTCACACTTACTATCGTGCTCTCCCTTCTCGTTCAGC
XCTTGTTTCTCCATATACTGTGACGAAGATGACTGTTACXGATCTCCTTGGGGTTACTCAAAATGCCAATTCTTCTGAAATCAAGAAAGC
TTATTACAAGCTCTCTCTAAAACATCATCCAGATAAAAACCCTGATCCAGAATCAAAGAAGCTTTTTGTGAAAATTGCAAATGCGTATGA
GATTTTGAAAAACGAAGCCACAAGGGAGCAGTATGATTATGCACTTGCCCATCCAGAGGAGTTTTTCTACAATACAGCACGGTATTACCA
TGCTTACTATGGTCACAAAACTGATACCCGTGCTGTGCTCGTTGGTCTTCTTTTGATAGTCTCAATATTTCAGTATCTGAATCAGTGGAC
AAGATATAATCAGGCTATTGACATGGTCAAGAAAACACCAGCTTATAAAAACAAGCTACGTGCTTTGGAGCTTCAACGCACTGGAGGAAT
GGCTAATAGGAAGAAGGGCAACAAGCCGATGGACAAGAAGGTGGAAGAAGAACTTGGCAAGGAACTCAACTTGGACATAAAGGGCACTGA
AAAGCCTGCTGTTTGGGATCTAATTGGAATTCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTATTGTGGTATGGGTGTTGGTT
CTGGAGGTACAATGTCAAGCGTGCTCCATACACATGGGAAGATGCCTCCTATTTGACACGAAGGTCCCTTCGGGCTTCTCTTGATTCATG
GATATCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTATGTGGCAGAGATGCG
CAAGGAATCAAAGCgCCGAAGATAAAAGTTCTTTTGTTTTTACTCAAAGCTATATGTGTAGTATGAGATCAGTTTTGATGGGGAGTATTC
TGAGTCATGAAGCCGAXAAGTCTAATGTTAAATTATTGAAGAgAGCAAAATTCTTTTGACAAGGAGAGCTATTGGATTGATAAGTATGTC
ATAGAACTTGGATTTTCACGGtCAGTGTCATAGCTATATTAGTACTCAAAATAATAAGTATACAAAAAACATATTGAGACAGATACAAGC
ATACTGCATTTGGAGCAATTTTGGGGGACAAGCTTCTTCTGATGAgTGCTGCTCCCCACGGTGATTTTGCTGTTGTAATGCTAGGTTAG\
(3')AATGTGTCGAAGCATCTATATGTTGTGAAAAGACAGGAATTCCGTTCCATATAATGAACTTCATACTTGGCTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan