ESTScan Details for Unigene SGN-U272304

Score 
415
Direction 
Forward
Predicted Peptide Sequence 
YANVISEDILLKEELEGLTANYPDRFKVYYVLNQPPEEWSGGVGFVSKEMIQTHCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQ
FQF
Predicted Coding Sequence 
TATGCTAATGTTATTTCTGAAGATATTCTTTTGAAGGAAGAGTTGGAGGGTCTTACTGCTAACTATCCTGATCGTTTCAAAGTTTATTAC
GTCTTGAATCAGCCTCCGGAAGAATGGAGTGGTGGTGTGGGATTTGTCTCCAAGGAAATGATCCAGACTCATTGCCCTGCCCCGGCAGAT
GACATTAAGATACTGAGGTGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGAAGCCCTTGGATATTCACCAGAGATGCAA
TTCCAATTTTAA\
Edits in Original Sequence 
(5')TATGCTAATGTTATTTCTGAAGATATTCTTTTGAAGGAAGAGTTGGAGGGTCTTACTGCTAACTATCCTGATCGTTTCAAAGTTTA
TTACGTCTTGAATCAGCCTCCGGAAGAATGGAGTGGTGGTGTGGGATTTGTCTCCAAGGAAATGATCCAGACTCATTGCCCTGCCCCGGC
AGATGACATTAAGATACTGAGGTGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGAAGCCCTTGGATATTCACCAGAGAT
GCAATTCCAATTTTAA\(3')CTTCTTTTTCTGTTTTCATTTTTATCTCCGCATTAAAATTAGCCTCGATTACAAGAGGTTGCGTTTTAT
AGTCTGGGAAAAGACATTTTCCATTTTTCAGTGAAGAGATTCAAAATCATGCTTTCAAGTTTGAATAACATCTCATCCTTGAGTAGAAAT
GTCCTCTATGCTATTCTGGTCTTGGTTCAAAGTGCACTAACATCAAAGTAACAGTTGAGTTGAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan