Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U272321

Score 
948
Direction 
Forward
Predicted Peptide Sequence 
HVVSSSLVHALSSPLNINLSFISHHQHNNSRTSIYSIEFXEPTKIGTNNHENYFPSSTSFSLLEFHGTKNLAHSRINGSVSLIPMARSQF
QPKKRRDIGTSNRNPSFSWMATVGEKVHNSTVPTSVPVRVALELLQAGHRYLDVRTAEEFSDGHAAGAINIPYMLRIGSGMIKNPNFLEE
VLEHFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYAAWTEGGLPIELEYKALIAFYLLTYXKGRLKNKYTILITYEYNXPVV
NMAKSIPVHHIKMCLKVKEATCKIFCIVIYIXVISDVGESVLQAMCKYCSPNSAVINNIGLKKKKKKNSRLVLSKPSVRPVPLEVHIQGY
PGKFYCPRMNSMNKPTYAAICTHSPTKPVLIFVSSRRQTRLTALDLIQFAASDEHPRQFISMPEDSLQMVLSQVTDQNLKHTLQFGIGLH
HAGLNDKDRSLVEELFANNKIQATMHPEICISVGVKYDEIGNYXLSHFGCIFLGVGLYKYVAWGVNLPAHLVVIKGTEFYDGKAKRYVDF
PITDILQMMGRAGSPQYDQHGKAVILVHEPKKSFYKKFLYEPFPXLKV
Predicted Coding Sequence 
XCCCATGTTGTTTCCTCCAGTCTTGTCCATGCCTTGTCTTCACCCTTAAATATCAATCTCTCTTTCATTTCTCACCATCAACACAATAAT
TCAAGAACTTCCATATATTCTATTGAATTTXCAGAGCCAACAAAAATAGGAACAAACAATCATGAGAACTATTTCCCTTCTTCAACCTCA
TTTTCACTTCTTGAGTTCCATGGTACCAAGAATTTGGCACACAGCAGGATCAATGGATCGGTTTCGTTAATTCCAATGGCAAGGTCTCAA
TTTCAGCCTAAAAAAAGACGTGACATTGGTACTAGCAATAGAAATCCAAGTTTTAGCTGGATGGCAACAGTTGGAGAGAAAGTGCACAAC
TCCACTGTTCCTACTTCTGTTCCTGTTCGAGTTGCACTGGAATTGCTTCAAGCTGGCCATCGTTATTTAGATGTCAGAACTGCTGAAGAG
TTCAGTGATGGGCATGCTGCTGGGGCCATAAACATTCCTTACATGCTTAGAATTGGATCAGGGATGATAAAGAACCCCAATTTCTTGGAG
GAAGTGTTGGAACATTTTGGGAAGGATGATGAAATTATAGTTGGATGCCAGTTGGGTAAGAGATCATTTATGGCTGCAACTGAACTTCTT
GCTGCTGGATTTACTGGGGTGACTGACATTGCTGGTGGATATGCTGCTTGGACAGAGGGTGGACTTCCGATTGAGCTTGAATATAAAGCA
TTAATAGCCTTTTATTTACTCACATATAXAAAGGGTAGATTAAAAAATAAGTACACCATCTTAATTACTTATGAATATAATAAXCCAGTA
GTCAACATGGCGAAATCAATTCCCGTTCATCACATCAAAATGTGTCTGAAAGTCAAAGAAGCAACTTGCAAGATCTTTTGTATAGTAATT
TATATTAXGGTGATATCCGATGTGGGAGAATCTGTATTGCAAGCAATGTGTAAATATTGTTCTCCTAATTCTGCTGTAATAAATAATATT
GGCCTGAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTCTCTAAGCCAAGTGTGAGGCCTGTTCCTCTTGAAGTTCATATTCAGGGA
TATCCTGGGAAGTTTTACTGCCCGAGGATGAATAGTATGAACAAGCCCACATATGCTGCTATATGTACACATTCACCAACAAAACCAGTT
CTAATCTTTGTCTCCTCTCGTCGCCAAACAAGGCTTACAGCACTGGACCTTATTCAGTTTGCGGCTTCAGATGAGCACCCAAGGCAGTTC
ATAAGCATGCCAGAAGATTCACTTCAGATGGTTCTTTCTCAAGTCACAGACCAGAACTTGAAGCACACCTTACAATTTGGAATTGGATTA
CACCATGCCGGGCTGAATGATAAAGACAGATCATTGGTTGAGGAACTGTTTGCAAACAACAAGATCCAGGCAACTATGCATCCTGAAATT
TGTATATCTGTAGGAGTAAAATATGATGAAATTGGAAATTATXATTTGAGTCATTTTGGCTGCATCTTTTTAGGTGTTGGTTTGTACAAG
TACGTTGCATGGGGTGTAAACCTTCCTGCACATTTGGTTGTTATTAAGGGAACAGAGTTTTATGATGGGAAGGCAAAAAGATATGTTGAT
TTCCCAATCACTGATATATTACAAATGATGGGTCGAGCTGGNTCTCCACAATATGATCAACACGGGAAAGCTGTTATTCTTGTTCATGAA
CCCAAAAAGAGCTTTTATAAAAAGTTTCTATATGAACCATTCCCAGXTTTGAAAGTX\
Edits in Original Sequence 
(5')XCCCATGTTGTTTCCTCCAGTCTTGTCCATGCCTTGTCTTCACCCTTAAATATCAATCTCTCTTTCATTTCTCACCATCAACACAA
TAATTCAAGAACTTCCATATATTCTATTGAATTTXCAGAGCCAACAAAAATAGGAACAAACAATCATGAGAACTATTTCCCTTCaTTCAA
CCTCATTTTCACTTCTTGAGTTCCATGGTACCAAGAATTTGGCACACAGCAGGATCAATGGATCGGTTTCGTTAATTCCAATGGCAAGGT
CTCAATTTCAGCCTAAAAAAAGACGTGACATTGGTACTAGCAATAGAAATCCAAGTTTTAGCTGGATGGCAACAGTTGGAGAGAAAGTGC
ACAACTCCACTGTTCCTACTTCTGTTCCTGTTCGAGTTGCACTGGAATTGCTTCAAGCTGGCCATCGTTATTTAGATGTCAGAACTGCTG
AAGAGTTCAGTGATGGGCATGCTGCTGGGGCCATAAACATTCCTTACATGCTTAGAATTGGATCAGGGATGATAAAGAACCCCAATTTCT
TGGAGGAAGTGTTGGAACATTTTGGGAAGGATGATGAAATTATAGTTGGATGCCAGTTGGGTAAGAGATCATTTATGGCTGCAACTGAAC
TTCTTGCTGCTGGATTTACTGGGGTGACTGACATTGCTGGTGGATATGCTGCTTGGACAGAGGGTGGACTTCCGATTGAGtCTTGAATAT
AAAGCATTAATAGCCTTTTATTTACTCACATATAXAAAGGGTAGATTAAAAAATAAGTACACCATCTTAATTACTTATGAATATAATAAX
CCAGTAGTCAACATGGCGAAATCAATTCCCGTTCATCACATCAAAATGTGTCTGAAAGTCAAAGAAGCAACTTGCAAGATCTTTTGTATA
GTAATTTATATTAXGGTGATATCCGATGTGGGAGAATCTGTATTGCAAGCAATGTGTAAATATTGTTCTCCTAATTCTGCTGTAATAAAT
AATATTGGCCTGAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTCTCTAAGCCAAGTGTGAGGCCTGTTCCTCTTGAAGTTCATATT
CAGGGATATCCTGGGAAGTTTTACTGCCCGAGGATGAATAGTATGAACAAGCCCACATATGCTGCTATATGTACACATTCACCAACAAAA
CCAGTTCTAATCTTTGTCTCCTCTCGTCGCCAAACAAGGCTTACAGCACTGGACCTTATTCAGTTTGCGGCTTCAGATGAGCACCCAAGG
CAGTTCATAAGCATGCCAGAAGATTCACTTCAGATGGTTCTTTCTCAAGTCACAGACCAGAACTTGAAGCACACCTTACAATTTGGAATT
GGATTACACCATGCCGGGCTGAATGATAAAGACAGATCATTGGTTGAGGAACTGTTTGCAAACAACAAGATCCAGGCAACTATGtCATCC
TGAAATTTGTATATCTGTAGGAGTAAtAATATGATGAAATTGGAAATTATXATTTGAGTCATTTTGGCTGCATCTTTTTAGGTGTTGGTT
TGTACAAGTACGTTaGCATGGGGTGTAAACCTTCCTGCACATTTGGTTGTTATTAAGGGAACAGAGTTTTATGATGGGAAGGCAAAAAGA
TATGTTGATTTCCCAATCACTGATATATTACAAATGATGGGTCGAGCTGGNTCgTCCACAATATGATCAACACGGGAAAGCTGTTATTCT
TGTTCATGAACCCAAAAAGAGCTTTTATAAAAAGTTTCTATATGAACCATTCCCAGXTTTGAAAGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan