ESTScan Details for Unigene SGN-U272369

Score 
793
Direction 
Forward
Predicted Peptide Sequence 
QKSLNGFPLIKLVPMAVFSPSCSSTSPLLSFKNNISFFPSTAVVFPEFAALSXVKATVSVESPSSSATDRCDDSPKVLLEVRDLCAVIVE
SKQQILNGVNLTVRQGEVHAVMGKNGSGKSTFAKVLVGHPDYEITGGTVSFKGENLLEMEPEERSLAGLFMSFQSPVAIPGVSNIDFLNM
AYNAQRRKLGLPELGPIEFYGYIAPKLELVNMKIDFLNRNVNEGFSGGERKRNEILQLAVLGADLAILDEIDSGLDVDALRDVAKAVNGL
LSAKEFGVDDYALLTIIRIHQADIYPYHGERENREAGDISIAKVLEKEGYKAISAHRAAMNDDDFFLVSSATRGNISTAPTLFKEVAISD
ASTFSSNDSKISVLNCLNM
Predicted Coding Sequence 
CAGAAGTCGTTAAACGGATTTCCACTTATCAAACTTGTTCCTATGGCTGTTTTCAGTCCCAGTTGTTCTTCTACTTCCCCACTTCTCTCC
TTCAAAAACAACATCTCTTTCTTCCCTTCCACCGCCGTTGTTTTCCCGGAGTTCGCTGCACTTTCAXCAGTGAAAGCCACCGTCAGCGTC
GAGTCTCCGTCGTCTTCCGCCACCGACCGCTGTGATGACTCGCCCAAGGTTTTACTTGAAGTCCGGGACCTATGCGCTGTCATAGTCGAG
TCAAAGCAGCAAATTCTCAATGGTGTTAACCTCACTGTCCGCCAAGGCGAGGTTCATGCTGTAATGGGTAAGAATGGTTCTGGAAAAAGC
ACCTTTGCCAAGGTTCTTGTTGGGCATCCAGATTATGAAATTACAGGAGGCACCGTGTCATTTAAAGGTGAGAATCTACTTGAGATGGAA
CCTGAGGAAAGATCTCTTGCTGGTCTTTTTATGAGCTTCCAGTCCCCAGTTGCCATACCTGGAGTAAGCAATATTGACTTTCTTAACATG
GCGTATAATGCTCAAAGGAGGAAACTTGGACTGCCAGAGCTGGGACCAATTGAGTTTTACGGGTACATTGCCCCGAAGCTTGAACTTGTC
AACATGAAGATAGACTTCTTGAACAGAAATGTAAATGAAGGATTCAGTGGTGGAGAAAGGAAGCGCAATGAGATTCTGCAACTAGCGGTT
CTCGGGGCTGACTTGGCAATACTGGATGAGATTGATTCTGGTTTAGATGTTGACGCACTTCGAGACGTAGCAAAGGCAGTAAATGGACTT
CTATCXGCCAAAGAATTCGGTGTTGATGATTACGCATTACTTACGATTATTAGAATTCATCAAGCCGACATATATCCATATCATGGAGAA
AGGGAGAATCGTGAAGCTGGAGACATATCAATAGCAAAAGTTCTGGAGAAAGAAGGCTACAAAGCAATTTCTGCCCATAGAGCTGCAATG
AATGATGATGATTTTTTTCTTGTCTCATCAGCTACTAGAGGAAATATTTCTACTGCTCCAACATTATTTAAGGAAGTGGCAATAAGTGAT
GCTTCCACTTTCTCATCAAATGATTCAAAAATATCAGTGCTCAATTGTCTCAACATGTAA\
Edits in Original Sequence 
(5')CAGAAGTCGTTAAACGGATTTCCACTTATCAAACTTGTTCCTATGGCTGTTTTCAGTCCCAGTTGTTCTTCTACTTCCCCACTTCT
CTCCTTCAAAAACAACATCTCTTTCTTCCCTTCaCACCGCCGTTGTTTTCCCGGAGTTCGCTGCACTTTCAXCAGTGAAAGCCACCGTCA
GCGTCGAGTCTCCGTCGTCTTCCGCCACCGACCGCTGTGATGACTCGCCCAAGGTTTTACTTGAAGTCCGGGACCTATGCGCTGTCATAG
TCGAGTCAAAGCAGCAAATTCTCAATGGTGTTAACCTCACTGTCCGCCAAGGCGAGGTTCATGCTGTAATGGGTAAGAATGGTTCTGGAA
AAAGCACCTTTGCCAAGGTTCTTGTTGGGCATCCAGATTATGAAATTACAGGAGGCACCGTGTCATTTAAAGGTGAGAATCTACTTGAGA
TGGAACCTGAGGAAAGATCTCTTGCTGGTCTTTTTATGAGCTTCCAGTCCCCAGTTGCCATACCTGGAGTAAGCAATATTGACTTTCTTA
ACATGGCGTATAATGCTCAAAGGAGGAAACTTGGACTGCCAGAGCTGGGACCAATTGAGTTTTACGGGTACATTGCCCCGAAGCTTGAAC
TTGTCAACATGAAGATAGACTTCTTGAACAGAAATGTAAATGAAGGATTCAGTGGTGGAGAAAGGAAGCGCAATGAGATTCTGCAACTAG
CGGTTCTCGGGGCTGACTTGGCAATACTGGATGAGATTGATTCTGGTTTAGATGTTGACGCACTTCGAGACGTAGCAAAGGCAGTAAATG
GACTTCTATCXGCCAAAGAATTCGGTGTTGATGATTACGCATTACTTACGATTATTAGAATTCATCAAGCCGACATATATCCATATCATG
GAGAAAGGGAGAATCGTGAAGaCTGGAGACATATCAATAGCAAAAGTTCTGGAGAAAGAAGGCTACAAAGCAATTTCTgGCCCATAGAGC
TGCAATGAATGATGATGATTTTTTTCgTTGTCTCATCAGCTACTAGAGGAAATATTTCTACTGCTCCAACATTATTTAAGGAAGTGGCAA
TAAGTGATGCTTCCACtTTTCTCATCAAATGATTCAAAAATATCAGTGCTCAATTGTCTCAACATGTAA\(3')GAGTAAGGATAAACTA
TGTCCTCTGATGTAGGCAAAATGAGGAATTTTTATGACATGGGGGATCGAGTCATATACTTGTATTTTATCCCGTCTTTTTTTTTTTTTT
TCTAAAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan