Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U272405

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
MGIWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGNPDSAVCGRDTVXAVSA
IVYVVDAADPDNLSISSSELHXPAEQAISEWYSIAGAGNKIDKPDSLSKQALTDQMGLKSITDREXVLLYDXPARIPPTLTQSLIGLLST
RNQRAX
Predicted Coding Sequence 
ATGGGTATCTGGGAAGCTTTTCTCAATTGGCTTCGAAGCCTCTTCTTTAAGCAGGAAATGGAGCTTTCATTGATAGGATTGCAAAATGCG
GGAAAAACATCTCTTGTAAATGTTATTGCTACTGGTGGATACAGTGAAGACATGATACCAACTGTGGGATTTAACATGCGCAAAGTGACT
AAAGGAAATGTCACAATAAAATTGTGGGACCTTGGAGGCAACCCAGATTCCGCAGTATGTGGGAGAGATACTGTCGXTGCTGTTTCTGCT
ATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATATCAAGTAGTGAACTCCATGAXCCTGCTGAGCAAGCCATCTCTGAG
TGGTATTCCATTGCTGGTGCTGGAAACAAGATTGACAAGCCTGATTCCCTGTCCAAACAGGCTTTGACTGACCAGATGGGATTGAAATCA
ATTACTGATAGAGAAGXTGTGCTGCTATATGATCXTCCTGCAAGAATTCCACCAACATTGACTCAGTCATTGATTGGCTTGTTAAGCACT
CGAAATCAAAGAGCTAAX\
Edits in Original Sequence 
CACAAATACAGAGGGAAAGGGAAAAAGGTATTTATTGTGTTATGTTTGAGAGGGATCTTTCTTCTTCATACTGATATTCTTATTCAGATC
TCTCTCTTTTACGATTCTTCGCATCAGCC
(5')ATGGGTATCTGGGAAGCTTTTCTCAATTGGCTTCGAAGCCTCTTCTTTAAGCAGGAA
ATGGAGCTTTCATTGATAGGATTGCAAAATGCGGGAAAAACATCTCTTGTAAATGTTATTGCTACTGGTGGATACAGTGAAGACATGATA
CCAACTGTGGGATTTAACATGCGCAAAGTGACTAAAGGAAATGTCACAATAAAATTGTGGGACCTTGGAGGtCAACCCAGATTCCGCAGT
ATGTGGGAGAGATACTGTCGXTGCTGTTTCTGCTATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATATCAAGTAGTGA
ACTCCATGAXCCTGCTGAGCAAGCCATCTCTGAGTGGTATTCCATTGCTGGTGCTgGGAAACAAGATTGACAAGCCTGATTCCCTGTCCA
AACAGGCTTTGACTGACCAGATGGGATTGAAATCAATTACTGATAGAGAAGXTGTGCTGCTATATGATCXTCCTGCAAGAATTCCACCAA
CATTGACTCAGTCATTGATTGGCTTGTTAAGCACTCGAAATCAAAGAGCTAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan