Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U272406

Score 
408
Direction 
Forward
Predicted Peptide Sequence 
PWVSGKLFSIGSEASSXKQEMELSLIGLQNAGKTSLVNVIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGNPDSEVCGKDIVXAVS
AIVYVVDAADHDNLSISKSELHDLLNKPSLSGIPLLVLGNKIDKPGALSKQALTDEMGLKSVTDREVCCYMISCKNSTNIDSVIDWLVKP
QNQRVKDDLLX
Predicted Coding Sequence 
XATCCATGGGTCTCTGGGAAGCTTTTCTCAATTGGCTCCGAAGCCTCTTCTTTXAAACAGGAAATGGAACTTTCTTTGATAGGGCTGCAA
AATGCAGGGAAAACTTCACTTGTAAATGTTATTGCTACTGGTGGATATAGTGAAGATATGATACCAACGGTGGGATTTAACATGAGGAAA
GTGACTAAAGGTAATGTCACTATAAAATTGTGGGACCTCGGAGGCAACCCAGATTCCGAAGTATGTGGGAAAGATATTGTCGXTGCAGTT
TCAGCTATAGTTTATGTTGTTGATGCTGCTGATCATGATAATCTTAGCATTTCTAAAAGTGAACTCCATGACCTGCTGAACAAGCCATCA
TTGAGTGGTATTCCGTTGCTGGTATTGGGGAACAAGATTGACAAACCTGGAGCTCTGTCCAAGCAGGCTTTGACTGATGAGATGGGATTG
AAATCAGTAACAGACAGAGAGGTGTGCTGCTATATGATATCATGCAAAAACTCCACCAATATTGACTCTGTCATTGATTGGCTTGTCAAG
CCTCAAAATCAAAGAGTTAAGGATGACCTACTGAXX\
Edits in Original Sequence 
(5')XATCCATGGGTCTCTGGGAAGCTTTTCTCAATTGGCTCCGAAGCCTCTTCTTTXAAACAGGAAATGGAACTTTCTTTGATAGGGCT
GCAAAATGCAGGGAAAACTTCACTTGTAAATGTTATTGCTACTGGTGGATATAGTGAAGATATGATACCAACGGTGGGATTTAACATGAG
GAAAGTGACTAAAGGTAATGTCACTATAAAATTGTGGGACCTCGGAGGtCAACCCAGATTCCGAAGTATGTGGGAAAGATATTGTCGXTG
CAGTTTCAGCTATAGTTTATGTTGTTGATGCTGCTGATCATGATAATCTTAGCATTTCTAAAAGTGAACTCCATGACCTGCTGAACAAGC
CATCATTGAGTGGTATTCCGTTGCTGGTATTGGGGAACAAGATTGACAAACCTGGAGCTCTGTCCAAGCAGGCTTTGACTGATGAGATGG
GATTGAAATCAGTAACAGACAGAGAGGTGTGCTGCTATATGATATCATGCAAAAACTCCACCAATATTGACTCTGTCATTGATTGGCTTG
TCAAGCaCTCAAAATCAAAGAGTTAAGGATGACCTACTGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan