ESTScan Details for Unigene SGN-U272441

Score 
129
Direction 
Forward
Predicted Peptide Sequence 
EYYNISPKTILKYAVSSLFNFPQKTDPLNEAEDLRLSLPNNDKVSAFIFAEIFTDFCFKFHYQSELGELLCNILKLQPSFLRANDHASSS
NESLGXLLALRKINIFAMGVSYLSVSAFCTVLSYVGLQCWMGISVEKLKSDGLIGESIINFGNESRALENLLGSHTTIALGANFAVNVFI
LLVLFLKTIFFGDLHSSEIRKLAX
Predicted Coding Sequence 
XTAGAGTACTATAATATATCTCCAAAGACAATTCTCAAGTATGCCGTTTCTTCACTCTTCAATTTCCCGCAAAAAACTGATCCATTGAAT
GAAGCTGAAGATCTCAGACTAAGTTTACCCAACAACGACAAGGTTTCTGCTTTCATCTTTGCTGAGATCTTTACAGATTTCTGCTTTAAG
TTCCACTACCAATCAGAATTAGGTGAACTTCTTTGCAATATACTXAAGTTGCAGCCATCATTTTTGAGGGCAAATGATCATGCTTCTTCT
TCTAATGAAAGTCTTGGAXTTCTGTTAGCTCTGAGAAAGATAAATATATTTGCCATGGGCGTAAGCTACTTGTCAGTTTCAGCATTCTGC
ACTGTTCTGAGCTATGTCGGACTCCAGTGTTGGATGGGAATTTCGGTTGAGAAACTAAAATCAGATGGGCTCATTGGGGAGAGCATTATC
AACTTTGGGAATGAAAGCCGTGCACTAGAGAACCTTTTAGGTTCACATACAACAATTGCTCTGGGAGCCAATTTTGCAGTCAACGTATTT
ATACTGCTAGTTTTGTTTCTTAAGACTATATTCTTTGGAGATTTGCACTCGTCAGAAATCCGAAAGCTGGCTGXX\
Edits in Original Sequence 
(5')XTAGAGTACTATAATATATCTCCAAAGACAATTCTCAAGTATGCCGTTTCTaTCACTCTTCAATTTCCCGCAAAAAACTGATCCAT
TGAcATGAAGCTGAAGATCTCAGACTAAGTTTACCCAACAACGACAAGGTTTCTGCTTTCATCTTTGtCTGAGATCTTTACAGATTTCTG
CTTTAAGTTCCACTACCAATCAGAATTAGGTGAACTTCTTTGCAATATACTXAAGTTGCAGCCATCATTTTTGAGGGCAAATGATCATGC
TTaCTTCTTCTAATGAAAGTCTTGGAXTTCTGTTAGCTCTGAGAAAGATAAATATATTTGCCATGGGCGTAAGCTACTTGTCAGTTTCAG
CATTCTGCACTGTTCTGAGCTATGTCGGACTCCAGTGTTGGATGGGAATTTCGGTTGAGAAACTAAAATCAGATGGGCTCATTGGGGAGA
GCATTATCAACTTTGGGAATGAAAGCCGTGCACTAGAGAACCTTTTAGGTTCACATACAACAATTGCTCTGGGAGCCAATTTTGCAGTCA
ACGTATTTATACTGCTAGTTTTGTTTCTTAAGACTATATTCTTTGGAGATTTGCACTCGTCAGAAATCCGAAAGCTGGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan