ESTScan Details for Unigene SGN-U272480

Score 
589
Direction 
Forward
Predicted Peptide Sequence 
VELKKLPPPLHCLSSAFAACSREEEKRNEKLKVARXMANEGINDTSCARKGSITHVIFDMDGLLLDTEKFYTEVQEIILARYNKTFDWSL
KAKMMGKKAIEAARVFVEETGISDSLTAEDFLVEREEMLQKMFPTSDLMPVHHAAFDLKTQRHSKLFSLMHHIVRGDDPEVKQGKPSPDI
FLAAANRFEDGPVDPQMILVFEDAPSGVLAAKNAGMQXLSPKILMSVVMVPDARLDSSYHQVADLVLNSLLDFSPDDWGLPPLENASTNS
ISXSLITILKFPNRAYYDAEXAGVDYNSRIQRLFQDPIGEXFEKITKDYGREKMIEED
Predicted Coding Sequence 
GTGGAACTCAAAAAGCTTCCTCCTCCTCTACACTGTCTCTCCTCCGCCTTTGCTGCTTGTAGCAGGGAGGAAGAAAAGAGGAACGAGAAG
CTAAAAGTTGCTCGAATXATGGCGAATGAAGGCATCAATGATACTTCATGTGCAAGAAAAGGCTCAATCACTCATGTAATCTTTGACATG
GACGGCCTTCTTTTAGACACCGAGAAATTCTATACGGAGGTCCAGGAGATTATACTTGCTAGGTATAATAAGACTTTTGATTGGTCACTC
AAGGCAAAGATGATGGGGAAGAAGGCAATAGAGGCTGCCAGGGTCTTTGTTGAAGAAACGGGAATAAGTGATTCACTTACAGCTGAAGAT
TTTCTTGTAGAGAGAGAGGAAATGTTGCAGAAAATGTTCCCCACAAGCGACCTCATGCCAGTACACCACGCGGCATTTGATTTGAAAACT
CAAAGACACAGCAAACTTTTTTCACTAATGCATCATATCGTTCGTGGTGATGATCCAGAAGTTAAACAAGGGAAGCCATCACCTGATATA
TTCCTTGCAGCTGCAAACAGATTTGAGGATGGACCAGTAGATCCACAGATGATTCTTGTATTTGAAGATGCGCCCTCTGGTGTCCTTGCA
GCCAAGAATGCTGGAATGCAAGXTCTATCACCAAAAATTTTAATGTCAGTAGTTATGGTTCCAGATGCAAGGTTGGATAGTTCATATCAT
CAAGTCGCTGATCTGGTTTTGAATTCTTTACTTGATTTCAGCCCAGACGATTGGGGATTGCCTCCATTAGAAAATGCATCAACAAACTCA
ATTAGTTTXAGTTTGATCACGATTCTTAAGTTCCCAAACAGAGCCTATTATGATGCTGAAXTTGCAGGAGTTGATTACAACTCGAGGATT
CAAAGGCTATTTCAGGATCCTATCGGAGAGGXTTTCGAGAAAATAACCAAAGATTATGGAAGAGAAAAAATGATTGAAGAAGATTGA\
Edits in Original Sequence 
(5')GTGGAACTCAAAAAGCTTCCTCCTCCTCTACACTGTCTCTCCTCCGCCTTTGCTGCTTGTAGCAGGGAGGAAGAAAAGAGGAACGA
GAAGCTAAAAGTTGCTCGAATXATGGCGAATGAAGGCATCAATGATACTTCATGTGCAAGAAAAGGCTCAATCACTCATGTAATCTTTGA
CATGGACGGCCTTCTTTTAGACACCGAGAAATTCTATACGGAGGTCCAGGAGATTATACTTGCTAGGTATAATAAGACTTTTGATTGGTC
ACTCAAGGCAAAGATGATGGGGAAGAAGGCAATAGAGGCTGCCAGGGTCTTTGTTGAAGAAACGGGAATAAGTGATTCACTTACAGCTGA
AGATTTTCTTGTAGAGAGAGAGGAAATGTTGCAGAAAATGTTCCCCACAAGCGACCTCATGCCAGTACACaCACGCGGCAcTTTGATTTG
AAAACTCAAAGACACAGCAAACTTTTTTCACTAATGCATCATATCGTTCGTGGTGATGATCCAGAAGTTAAACAAGGGAAGCCATCACCT
GATATATTCCTTGCAGCTGCAAACAGATTTGAGGATGGACCAGTAGATCCACAGATGATTCTTGTATTTGAAGATGCGCCCTCTGGTGTC
CTTGCAGCCAAGAATGCTGGAATGCAAGXTCTATCACCAAAAATTTTAATGTCAGTAGTTATGGTTCCAGATGCAAGGTTGGATAGTTCA
TATCATCAAGTCGCTGATCTGGTTTTGAATTCTTTACTTGATTTCAGCCCAGACGATTGGGGATTGCCTCCATTAGAAAATGCATCAACA
AACTCAATTAGTTTXAGTTTGATCACGATTCTTAAGTTCCCAAACAGAGCCTATTATGATaGCTGAAXTTGCAGGAGTTGATTACAACTC
GAGGATTCAAAGGCTATTTCAGGATCCTATCGGAGAGGXTTTCGAGAAAATAACCAAAGATTATGGAAGAGAAAAAATGATTGAAGAAGA
TTGA\(3')ATGTAGACAAACAACATGTATCTATTATTTCTTTATTTACAATGACTTGTACAAGTATTTATAGTTGCATACAATGAAAGA
GGAAGAGCTAAATCTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan