Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U272529

Score 
799
Direction 
Forward
Predicted Peptide Sequence 
MEKSHENVEAYGWAARDTSGVLSPFNFSRRVTGEKDVQFIVEFXHSDLHQLKNEWSNSIYPMVPGHGVVGVVTEVGSKVEKFKIGDKVGV
GCLVGSCRKCENCDNDLENYCRDQIMTYNGVYTDGIPTYGGYSDIMVTNEHYXGPLAQKFTNGSSSPVMAGITTYSPLRYYGLDKPGMHI
GVVGLGGLGHMAVKFAKAFGTKVTVISTSVSKKDDAIDRLGADSFLVSRDPDQMQGAAGSLDGIIDTVSAIHPLLPLINLLKTHGKLVMV
GAPEKPLELPXISPAFRKEASGREAAGGMKETQEMVDFVGKHNITPDVEVVPMDYVNTVLKRLLKSDVK
Predicted Coding Sequence 
ATGGAAAAATCACATGAAAATGTTGAGGCATATGGATGGGCAGCTAGAGATACTTCTGGGGTACTTTCTCCTTTCAACTTCTCAAGAAGG
GTGACTGGTGAAAAAGATGTGCAATTTATTGTGGAATTTGXTCATTCTGATCTTCATCAACTCAAGAATGAATGGAGCAATAGTATATAT
CCAATGGTACCAGGGCATGGAGTTGTTGGTGTAGTAACTGAAGTTGGTAGCAAAGTTGAGAAATTCAAAATTGGTGACAAAGTTGGAGTT
GGATGTTTAGTAGGATCATGTAGAAAATGTGAAAATTGTGACAACGATCTTGAAAATTATTGTCGCGATCAGATCATGACATACAATGGT
GTTTACACCGATGGAATCCCCACGTATGGTGGTTACTCCGATATAATGGTAACCAACGAGCACTACXGTGGTCCATTGGCCCAAAAATTT
ACCAATGGAAGCAGCTCCCCTGTTATGGCAGGGATCACAACTTATAGTCCTTTGAGGTATTACGGACTAGATAAACCTGGAATGCACATT
GGTGTTGTTGGTCTGGGTGGTTTGGGACATATGGCTGTGAAATTTGCTAAGGCGTTCGGAACCAAAGTTACTGTGATAAGTACATCTGTT
AGTAAGAAAGACGACGCAATTGATCGTTTAGGGGCAGACTCGTTTTTGGTCAGTCGTGACCCTGACCAAATGCAGGGTGCAGCGGGGTCA
CTAGATGGCATCATCGATACTGTATCCGCGATTCACCCTCTTCTTCCATTGATTAATTTGTTGAAAACTCATGGGAAGCTTGTGATGGTT
GGTGCCCCTGAAAAACCACTAGAGTTGCCTGXTATTTCCCCTGCTTTTAGGAAGGAAGCTAGTGGCAGGGAGGCGGCAGGAGGAATGAAG
GAGACACAAGAGATGGTAGATTTCGTGGGGAAGCATAACATAACACCAGATGTTGAAGTCGTGCCAATGGACTATGTGAATACAGTGTTG
AAACGCCTTTTGAAATCAGATGTGAAGTAA\
Edits in Original Sequence 
AATAATATCTCAAAAAATACACAAAAATCAAGAAA(5')ATGGAAAAATCACATGAAAATGTTGAGGCATATGGATGGGCAGCTAGAGAT
ACTTCTGGGGTACTTTCTCCTTTCAACTTCTCAAGAAGGGTGACTGGTGAAAAAGATGTGCAATTTATTGTGGAATTTGXTCATTCTGAT
CTTCATCAACTCAAGAATGAATGGAGCAATAGTATATATCCAATGGTACCAGGGCATGGAGTTGTTGGTGTAGTAACTGAAGTTGGTAGC
AAAGTTGAGAAATTCAAAATTGGTGACAAAGTTGGAGTTGGATGTTTAGTAGGATCATGTAGAAAATGTGAAAATTGTGACAACGATCTT
GAAAATTATTGTCGCGATCAGATCATGACATACAATGGTGTTTACACCGATGGAATCCCCACGTATGGTGGTTACTCCGATATAATGGTA
ACCAACGAGCACTACXGTGGTCCATTGGCCCAAAAATTTACCAATGGAAGCAGCTCCCCTGTTATGtGCAGGGATCACAACTTATAGTCC
TTTGAGGTATTACGGACTAGATAAACCTGGAATGCACATTGGTGTTGTTGGTCTGGGTGGTTTGGGACATATGGCTGTGAAATTTGCTAA
GGCGTTCGGAACCAAAGTTACTGTGATAAGTACATCTGTTAGTAAGAAAGACGACGCAATTGATCGTTTAGGGGCAGACTCGTTTTTGGT
CAGTCGTGACCCTGACCAAATGCAGGGTGCAGCGGGGTCACTAGATGGCATCATCGATACTGTATCCGCGATTCACCCTCTTCTTCCATT
GATTAATTTGTTGAAAACTCATGGGAAGCTTGTGATGGTTGGTGCCCCTGAAAAACCACTAGAGTTGCCTGXTATTTCCCCTGCTTTTAG
GAAGGAAGCTAGTGGCAGGGAGcGCGGCAGGAGGAATGAAGGAGACACAAGAGATGGTAGATTTCGTGGGGAAGCATAACATAACACCAG
ATGTTGAAGTCGTGCCAATGGACTATGTGAATACAGTGTTGAAACGCCTTTTGAAATCAGATGTGAAGTAA\(3')CGTTTTGTGCTTGA
CATTGGCAGCACATTGAACAAGAATTGAGATGAGAGGGACATCTTGGTCAAGAAAATGAGTGTGTTATAGGGTTATGATTTTGTATTAAG
CTTGTAATTTTGTTGTTTAAATTTCTTATGTTTTGTGTATCAAAAGGAATAAGGAGAATAAATACGATATTCTGTTTTCTGGTATTGACA
CTCAATAAAAACTTATCAGCATTCAACGTTTACATCAAAAAGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan