ESTScan Details for Unigene SGN-U272530

Score 
1033
Direction 
Forward
Predicted Peptide Sequence 
MAKSFENEHPIKAFGWATRDTSGVLSPFNFSRRVTGEKDVQFKVMYCGICHSDLHQLKNEWGNSKYPMVPGHEVVGVVIEVGSKVEKFKV
GDKVGVGCMVGSCRKCENCSVDLENYCPRQIPTYNGYSLDGTFTFGGYSDMMVSDEHFVVHWPENLSMDAAPLLCAGITTYSPLKYFGLD
KPGMHIGVVGLGGLGHMAVKFAKAFGTKVTVISTSANKKQEAIERLGAXLFLDHRDPEQMKAAMNTLDGIIDTVSAVHPILPLLMLMKSH
GKLVMVGAPEKPVELPVFPLLMGRKLVAGSCIGGMKETQEMLDFAAKHNITPDIEVVPMDYVNTALERLLKSDVKYRFVLDIGNTLNKK
Predicted Coding Sequence 
ATGGCAAAATCATTTGAAAATGAACATCCAATTAAGGCATTTGGATGGGCAACTAGAGACACTTCTGGAGTTCTTTCTCCTTTCAATTTT
TCAAGAAGGGTGACAGGTGAAAAAGATGTGCAATTTAAAGTTATGTATTGTGGAATTTGTCATTCTGATCTTCATCAACTCAAGAATGAA
TGGGGAAATAGCAAGTACCCGATGGTGCCTGGGCATGAGGTTGTTGGTGTTGTAATTGAGGTTGGAAGCAAGGTGGAGAAATTTAAGGTT
GGAGACAAAGTAGGTGTTGGATGTATGGTAGGATCATGTCGAAAATGTGAGAATTGTAGCGTGGATCTCGAGAATTACTGCCCTCGTCAG
ATTCCTACTTACAACGGCTATAGCTTAGACGGAACCTTCACGTTTGGAGGTTACTCTGACATGATGGTATCCGATGAGCATTTTGTAGTA
CATTGGCCTGAAAACTTGTCGATGGACGCTGCTCCCCTGTTATGTGCTGGAATTACTACTTATAGTCCTTTGAAATATTTTGGACTCGAT
AAGCCTGGAATGCACATTGGTGTTGTTGGTCTTGGAGGGCTCGGACATATGGCTGTTAAGTTTGCTAAGGCATTCGGAACCAAAGTGACT
GTCATTAGTACATCTGCTAATAAGAAGCAAGAAGCAATTGAGCGTTTAGGCGCAGAXCTCTTTCTTGATCATCGCGATCCTGAGCAGATG
AAGGCTGCAATGAACACATTGGATGGGATTATCGACACTGTTTCGGCGGTGCACCCTATTCTTCCATTGCTTATGTTGATGAAATCTCAT
GGTAAGCTAGTTATGGTTGGTGCACCAGAAAAACCGGTGGAGTTGCCCGTGTTTCCTCTACTTATGGGAAGGAAGCTAGTGGCTGGAAGT
TGCATAGGAGGGATGAAAGAGACTCAAGAAATGTTGGACTTCGCAGCAAAGCATAACATAACACCAGATATTGAAGTTGTGCCTATGGAC
TATGTGAACACAGCGTTGGAACGTCTTCTGAAATCGGACGTGAAGTATCGTTTCGTGCTCGACATTGGCAATACATTAAACAAGAAATGA
\
Edits in Original Sequence 
TCCTACATTCTTCTCTATTATAATTTATACTATATATACACTACATAAATATTTTTATTTTTCAAACGAAAAA(5')ATGGCAAAATCAT
TTGAAAATGAACATCCAATTAAGGCATTTGGATGGGCAACTAGAGACACTTCTGGAGTTCTTTCTCCTTTCAATTTTTCAAGAAGGGTGA
CAGGTGAAAAAGATGTGCAATTTAAAGTTATGTATTGTGGAATTTGTCATTCTGATCTTCATCAACTCAAGAATGAATGGGGAAATAGCA
AGTACCCGATGGTGCCTGGGCATGAGGTTGTTGGTGTTGTAATTGAGGTTGGAAGCAAGGTGGAGAAATTTAAGGTTGGAGACAAAGTAG
GTGTTGGATGTATGGTAGGATCATGTCGAAAATGTGAGAATTGTAGCGTGGATCTCGAGAATTACTGCCCTCGTCAGATTCCTACTTACA
ACGGCTATAGCTTAGACGGAACCTTCACGTTTGGAGGTTACTCTGACATGATGGTATCCGATGAGCATTTTGTAGTACATTGGCCTGAAA
ACTTGTCGATGGACGCTGCTCCCCTGTTATGTGCTGGAATTACTACTTATAGTCCTTTGAAATATTTTGGACTCGATAAGCCTGGAATGC
ACATTGGTGTTGTTGGTCTTGGAGGGCTCGGACATATGGCTGTTAAGTTTGCTAAGGCATTCGGAACCAAAGTGACTGTCATTAGTACAT
CTGCTAATAAGAAGCAAGAAGCAATTGAGCGTTTAGGCGCAGAXCTCTTTCTTGATCAgTCGCGATCCTGAGCAGATGAAGGCTGCAATG
AACACATTGGATGGGATTATCGACACTGTTTCGGCGGTGCACCCTATTCTTCCATTGCTTATGTTGATGAAATCTCATGGTAAGCTAGTT
ATGGTTGGTGCACCAGAAAAACCGGTGGAGTTGCCCGTGTTTCCTCTACTTATGGGAAGGAAGCTAGTGGCTGGAAGTTGCATAGGAGGG
ATGAAAGAGACTCAAGAAATGTTGGACTTCGCAGCAAAGCATAACATAACACCAGATATTGAAGTTGTGCCTATGGACTATGTGAACACA
GCGTTGGAACGTCTTCTGAAATCGGACGTGAAGTATCGTTTCGTGCTCGACATTGGCAATACATTAAACAAGAAATGA\(3')GAATATT
AATAGGGGGATTTACGTCCAATGGTCTAGCAGTGTTTCTTTGCTTAGATTGCATTAATTTCAGAGATGATTAATCAATAAAATGTGTTTC
TTGCACTTACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan