Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U272531

Score 
437
Direction 
Forward
Predicted Peptide Sequence 
TFQDRKTLKVSPLTXLTQKTAAPNHPRLQPKTPISLSSSSSGEELKAPVTGAKQHQTPFLFPFTISISIFRRSPAVPSSGATQSRPTKQP
PKTIGNDPKQPPNSGETPFQNPIPESGESTPVLRPNRPHDTDPSPFPFTIFFNFVLQVYELRPPQNCKLQALMDSDTIPNSISANNFRFI
SRDVNNGKLVMVGAPEKPLELYDFPAFRKETSGGERDRRDEGDTRDGDFAGKHNITPDVEVLMDYVNTTLERLLKSDVKYRFVLDIGNTL
NKS
Predicted Coding Sequence 
ACTTTCCAAGATAGAAAAACCCTAAAAGTTTCTCCTCTTACAXTCTTGACACAAAAAACAGCTGCACCAAACCACCCTCGTCTCCAACCC
AAAACCCCGATCTCTCTGTCCTCTTCTAGCTCCGGCGAGGAGCTCAAAGCTCCAGTGACCGGAGCTAAACAACACCAGACCCCTTTCCTC
TTCCCCTTCACGATTTCTATTTCTATTTTTCGCAGGTCACCGGCAGTCCCGAGCTCCGGCGCCACCCAATCCAGACCAACCAAACAACCC
CCAAAAACCATCGGAAACGACCCCAAACAGCCACCAAACTCCGGCGAAACCCCATTCCAAAACCCCATACCGGAATCCGGCGAATCAACT
CCXGTTCTAAGACCAAATAGACCCCACGATACAGACCCATCCCCTTTCCCCTTTACAATTTTTTTTAATTTTGTTTTGCAGGTGTATGAG
CTCCGACCACCACAAAACTGCAAGCTCCAAGCTCTAATGGACAGTGACACCATCCCAAACAGCATCTCCGCCAATAATTTTAGATTTATC
TCCAGGGATGTAAACAATGGGAAGCTTGTGATGGTTGGTGCCCCTGAAAAACCACTAGAGTTGTATGATTTCCCTGCTTTTAGGAAGGAA
ACTAGTGGCGGGGAGCGGGATAGGAGGGATGAAGGAGACACAAGAGATGGAGATTTCGCGGGGAAGCATAACATAACACCAGATGTTGAA
GTGCTAATGGACTACGTGAATACAACGTTGGAACGCCTTTTGAAATCGGACGTGAAGTATCGTTTTGTGCTTGACATTGGCAACACATTG
AACAAGAGTTGA\
Edits in Original Sequence 
(5')ACTTTCCAAGATAGAAAAACCCTAAAAGTTTCTCCTCTTACAXTCTTGACACAAAAAACAGCTGCACCAAACCACCCTCGTCTCCA
ACCCAAAACCCCGATCTCTCTGTCCTCTTCTAGCTCCGGCGAGGAGCTCAAAGCTCCAGTGaACCGGAGCTAAACAACACCAGACCCCTT
TCCTCTTCCCCTTCACGATTTCTATTTCTATTTTTCGCAGGTCACCGGCAGTCCCGAGCTCCGGCGCCACCCAATCCAGACCAACCAAAC
AACCCCCAAAAACCATCGGAAACGACCCCAAACAGCCACCAAACTCCGGCGAAACCCCATTCCAAAACCCCATACCGGAATCCGGCGAAT
CAACTCCXGTTCTAAGACCAAATAGACCCCACGATACAGACCCATCCCCTTTCCCCTTTACAATTTTTTTTAATTTTGTTTTGCAGGTGT
ATGAGCTCCGACCACCACAAAACTGCAAGCTCCAAGCTCTAATGGACAGTGACACCATCCCAAACAGCATCTCCgGCCAATAATTTTAGA
TTTATCTCCAGGGATGTAAACAATGGGAAGCTTGTGATGGTTGGTGCCCCTGAAAAACCACTAGAGTTGTATGtATTTCCCTGCTTTTAG
GAAGGAAACTAGTGGCGGGGAGCGGGATAGGAGGGATGAAGGAGACACAAGAGATGGtAGATTTCGCGGGGAAGCATAACATAACACCAG
ATGTTGAAGTGCTAATGGACTACGTGAATACAACGTTGGAACGCCTTTTGAAATCGGACGTGAAGTATCGTTTTGTGCTTGACATTGGCA
ACACATTGAACAAGAGTTGA\(3')GATGAGGGAGACATCTTGGTCAAGAAAATGAGTGTGTCATAAGGTTATGACTTTGGTATTAAGCT
TGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan