Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U272586

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
ETSLYSQKLASKLFQDDGFIAAVAKSEPFDSNEYSKSRADIISLQTVFDPNGKPQKDNSSDPFLRNPSSGLVYGRLFVTGKHTRKSDILN
MLGSSRLSPDDVRFEYNMNYAPVSVMIQFPTRNSYEATLREGNRKGGLFRMERVGRQQWDTLPRYDGKTILLVGVPRNAVAEDVERFLAG
CQYDASAIQMFGRPQRASDRPPTRTVFVEFPSQAKATHAFIXEEQRLLS
Predicted Coding Sequence 
XXCGAAACTTCACTGTACTCTCAAAAATTAGCTTCGAAGTTGTTCCAAGATGATGGGTTTATTGCTGCTGTGGCTAAATCXGAACCGTTC
GATTCAAACGAGTATTCAAAATCAAGGGCTGACATTATCTCTCTGCAGACAGTTTTCGACCCAAATGGAAAACCCCAGAAGGACAATTCA
TCTGATCCATTCCTCCGAAACCCATCTTCTGGTTTGGTTTATGGGAGACTTTTTGTCACTGGAAAGCATACAAGGAAGAGTGACATTCTT
AACATGTTAGGGAGTTCTAGATTGAGCCCAGATGACGTTAGATTTGAGTACAACATGAACTATGCTCCAGTTTCAGTGATGATTCAGTTC
CCTACTCGAAATTCTTATGAGGCTACACTTAGGGAAGGAAATCGGAAGGGTGGCTTATTCAGAATGGAGAGGGTTGGTCGTCAACAGTGG
GACACTTTGCCACGCTATGATGGAAAAACTATTTTATTGGTAGGGGTCCCTCGAAATGCAGTTGCCGAAGATGTGGAACGTTTCCTTGCT
GGTTGCCAGTATGATGCATCAGCAATCCAAATGTTCGGCAGACCACAACGAGCTTCTGATAGACCACCAACTAGAACAGTCTTTGTGGAG
TTTCCCTCGCAGGCTAAGGCAACACATGCATTTATTXACGAAGAACAGAGGCTTCTGTCTTAA\
Edits in Original Sequence 
(5')XXCGAAACTTCACTGTACTCTCAAAAATTAGCTTCGAAGTTGTTCCAAGATGATGGGTTTATTGCgTGCTGTGGCTAAATCXGAAC
CGTTCGATTCAAACGAGTATTCAAAATCAAGGGCTGACATTATCTCTCTGCAGACAGTTTTCGACCCAAATGGAAAcACCCCAGAAGGAC
AATTCATCTGATCCATTCCTCCGAAACCCATCTTCTGGTTTGGTTTATGGGAGACTTTTTGTCACTGGAAAGCATACAAGGAAGAGTGAC
ATTCTTAACATGTTAGGGAGTTCTAGATTGAGCCCAGATGACGTTAGATTTGAGTACAACATGAACTATGCTCCAGTTTCAGTGATGATT
CAGTTCCCTACTCGAAATTCTTATGAGGCTACACTTAGGGAAGGAAATCGGAAGGGTGGCTTATTCAGAATGGAGAGGGTTGGTCGTCAA
CAGTGGGACACTTTGCCACGCTATGATGGAAAAACTATTTTATTGGTAGGGGTCCCTCGAAATGCAGTTGCCGAAGATGTGGAACGTTTC
CTTGCTGGTTGCCAGTATGATGCATCAGCAATCCAAATGTTCGGCAGACCACAACGAGCTTCTGATAGACCACCAACTAGAACAGTCTTT
GTGGAGTTTCCCTCGCAGGCTAAGGCAACACATGCATTTATTXACGAAGAACAGAGGCTTCTGTCTTAA\(3')TAACCAAATTACAGTG
CGACTTCTTCAGTAATCTCATCCATCTCCAAGATAATCTACGTTTTGTTTCCCTGTTGGTGATGCTCAATTGCTAGGATGTCGATGATGA
TTTGGAATGCTTGGATTGTGTACCTTCTTGTCCAGGCTTCAATCCTTCCATCAGAGAACTATTTTCATTTACGGTAGGAAAAGTTGAGAT
GAAAGTCCAAATAATATAACCTTATCAATATTTTGAATGACATTGTTTTGCAAAACTGTCCAAGGAGGGACCAAAAAGGAGATGTTCTTA
GCTTTTGTTTGGATTGTTTGTTCTTAGCTTTTGCTTGGATTGTTTGATCCAGTCATCAAGCGTTGTCTTTAGAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan