ESTScan Details for Unigene SGN-U272654

Score 
1609
Direction 
Forward
Predicted Peptide Sequence 
FIQSKSTMESCVLISKKFPTNXNNLAMLYDKLYSVQKHKYXNSPPITSFTPTLSSIFXKALPVTTTLPSQSMDGHSGMHGHGFGNARTPL
LDRHALGRKRNDAGDGQLGDLEHGDSVPAPNVGFGRVISLAKPEAGNLVLATIALLFAATSSILIPKFGGKIIDIVSGDIQTPEQKSEAL
NAVKNTILEIFLIVIVGSVCTALEAWLFSSASERVVARLRKNLLSHLVHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLA
TAFIGLGFMFQTSWKLTLLSLAVVPVISVAVRRFGRYMRELSHKTQAAAAVASSIAEETFGAIRTVRSFAQEDYEISRYSEKVDETLNLG
LGQAKVVGLFSGSLNAASTLSVIVVVIYGATLTIQGAMTPGALTSFILYSLTVGSSVSGLSGLYTVAMKAAGASRRVFQILDRTSSMPKS
GDLCPLGDQAAEVELDDVWFAYPSRPSHMVLKGITMKLQSGSKVALVGPSGGGKTTIANLIERFYDPVKGKILLNGVSLVEISHKHLHHK
VSIVSQEPVLFNCSIEENIAYGLGGKVSSEDIEKAAKMANAHEFVSKFPEKYQTHVGERGLRLSGGQKQRIAIARALLMNPTILLLDEAT
SALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVKSANTVAVVSDGQIVESGTHDDLXEQEWDLHSTGEEAVAGIQI
Predicted Coding Sequence 
XXCTTTATTCAGAGCAAGTCGACTATGGAGTCTTGCGTCTTGATCTCCAAGAAATTCCCCACTAATXATAATAACTTAGCAATGCTATAC
GACAAATTGTATAGTGTACAAAAACACAAATATAAXAACTCACCACCCATTACATCATTCACTCCCACACTTTCTTCCATTTTTGAXAAA
GCTCTACCTGTGACCACCACACTTCCTTCTCAATCCATGGACGGCCATTCAGGAATGCATGGCCATGGCTTCGGTAATGCCAGAACTCCT
TTGTTAGACAGACATGCCTTAGGGAGAAAGAGAAATGATGCTGGAGATGGTCAGCTGGGAGACCTTGAGCATGGTGATTCTGTTCCGGCA
CCAAATGTTGGATTTGGCAGAGTTATTTCACTTGCAAAGCCTGAAGCAGGAAATTTGGTATTGGCCACAATTGCTTTGCTGTTTGCAGCA
ACATCAAGCATTTTGATTCCAAAATTTGGGGGAAAGATAATTGATATTGTTTCAGGTGATATCCAAACACCTGAACAAAAATCAGAAGCT
TTAAATGCAGTCAAGAACACAATACTTGAAATCTTTCTGATTGTCATCGTCGGTTCTGTTTGCACAGCACTTGAAGCATGGTTATTTTCT
TCTGCTAGTGAAAGGGTTGTAGCTAGGTTGAGAAAGAACTTGCTAAGTCACCTTGTTCACCAGGAGATAGCTTTCTTCGATGTTACTCGA
ACTGGGGAGCTCCTCAGTAGGCTATCTGAAGATACCCAGATCATAAAGAATGCTGCAACTACTAATCTTTCAGAGGCTTTGAGGAATCTT
GCTACTGCATTTATTGGTCTTGGGTTTATGTTTCAAACATCATGGAAATTAACATTGTTGTCGCTAGCTGTTGTACCAGTCATATCAGTT
GCAGTACGCAGATTTGGTCGCTACATGCGTGAGCTTTCCCACAAAACTCAAGCTGCTGCAGCAGTAGCCTCGTCCATTGCTGAGGAAACT
TTTGGCGCCATACGCACAGTGAGATCATTTGCGCAGGAAGATTACGAGATTTCACGCTATTCGGAGAAAGTTGATGAGACCTTAAATCTT
GGGCTTGGACAAGCTAAAGTGGTTGGCCTTTTCTCTGGAAGCTTAAATGCTGCATCTACTCTATCAGTTATTGTAGTAGTAATATATGGA
GCCACTCTGACTATCCAAGGCGCTATGACACCTGGAGCTCTTACATCCTTTATACTCTACAGCTTAACAGTTGGATCATCCGTATCTGGA
CTTTCTGGATTATATACTGTAGCAATGAAAGCTGCTGGAGCCAGCAGACGGGTTTTTCAGATCTTGGATCGCACATCATCCATGCCAAAA
TCAGGAGACCTATGTCCATTGGGTGATCAAGCTGCAGAGGTTGAACTGGATGATGTCTGGTTTGCCTATCCATCACGTCCTAGCCACATG
GTCCTCAAGGGTATAACAATGAAACTACAATCTGGTTCAAAGGTTGCACTGGTTGGTCCAAGTGGTGGTGGAAAGACTACAATAGCAAAT
TTGATAGAGAGATTCTATGATCCTGTTAAAGGGAAGATCTTGCTCAATGGGGTTTCTCTGGTTGAAATATCTCATAAGCACCTACACCAT
AAGGTTAGTATAGTGAGCCAGGAACCTGTTCTTTTCAACTGTTCCATCGAAGAAAATATTGCCTATGGATTGGGCGGCAAAGTAAGCAGT
GAAGATATAGAAAAAGCAGCTAAAATGGCTAATGCTCATGAATTTGTATCCAAATTTCCCGAAAAATATCAAACCCATGTCGGAGAACGA
GGATTGAGACTTTCTGGTGGTCAGAAACAGAGAATTGCCATAGCTAGAGCACTGCTGATGAACCCTACAATTTTATTGTTGGATGAGGCC
ACGAGTGCTCTGGATGCTGAAAGTGAATATCTTGTTCAGGATGCCATGGATTCCCTGATGAAAGGTAGAACCGTTCTTGTCATAGCTCAC
AGGCTTTCAACAGTCAAGAGCGCGAATACTGTAGCTGTTGTTTCGGATGGTCAAATAGTGGAAAGTGGCACACATGATGACCTTXCTGAA
CAAGAATGGGATCTACACAGCACTGGTGAGGAGGCAGTTGCAGGGATACAAATCTGA\
Edits in Original Sequence 
(5')XXCTTTATTCAGAGCAAGTCGACTATGGAGTCTTGCGTCTTGATCTCCAAGAAATTCCCCACTAATXATAATAACTTAGCAATGCT
ATACGACAAATTGTATAGTGTACAAAAACACAAATATAAXAACTCACCACCCATTACATCATTCACTCCCACACTTTCTTCCATTTTTGA
XAAAGCTCTACCTGTGACCACCACACTTCCaTTCTCAATCCATGGACGGCCATTCAGGAATGCATGGCCATGGCTTCGGTAATGCCAGAA
CTCCTTTGTTAGACAGACATGCCTTAGGGAGAAAGAGAAATGATGCTGGAGATGGTCAGCTGGGAGACCTTGAGCATGGTGATTCTGTTC
CGGCACCAAATGTTGGATTTGGCAGAGTTATTTCACTTGCAAAGCCTGAAGCAGGAAATTTGGTATTGGCCACAATTGCTTTGCTGTTTG
CAGCAACATCAAGCATTTTGATTCCAAAATTTGGGGGAAAGATAATTGATATTGTTTCAGGTGATATCCAAACACCTGAACAAAAATCAG
AAGCTTTAAATGCAGTCAAGAACACAATACTTGAAATCTTTCTGATTGTCATCGTCGGTTCTGTTTGCACAGCACTTcGAAGCATGGTTA
TTTTCTTCTGCTAGTGAAAGGGTTGTAGCTAGGTTGAGAAAGAACTTGCTAAGTCACCTTGTTCACCAGGAGATAGCTTTCTTCGATGTT
ACTCGAACTGGGGAGCTCCTCAGTAGGCTATCTGAAGATACCCAGATCATAAAGAATGCTGCAACTACTAATCTTTCAGAGGCTTTGAGG
AATCTTGCTACTGCATTTATTGGTCTTGGGTTTATGTTTCAAACATCATGGAAATTAACATTGTTGTCGCTAGCTGTTGTACCAGTCATA
TCAGTTGCAGTACGCAGATTTGGTCGCTACATGCGTGAGCTTTCCCACAAAACTCAAGCTGCTGCAGCAGTAGCCTCGTCCATTGCTGAG
GAAACTTTTGGCGCCATACGCACAGTGAGATCATTTGCGCAGGAAGATTACGAGATTTCACGCTATTCGGAGAAAGTTGATGAGACCTTA
AATCTTGGGCTTGGACAAGCTAAAGTGGTTGGCCTTTTCTCTGGAAGCTTAAATGCTGCATCTACTCTATCAGTTATTGTAGTAGTAATA
TATGGAGCCACTCTGACTATCCAAGGCGCTATGACACCTGGAGCTCTTACATCCTTTATACTCTACAGCTTAACAGTTGGATCATCCGTA
TCTGGACTTTCTGGATTATATACTGTAGCAATGAAAGCTGCTGGAGCCAGCAGACGGGTTTTTCAGATCTTGGATCGCACATCATCCATG
CCAAAATCAGGAGACCTATGTCCATTGGGTGATCAAGCTGCAGAGGTTGAACTGGATGATGTCTGGTTTGCCTATCCATCACGTCCTAGC
CACATGGTCCTCAAGGGTATAACAATGAAACTACAATCTGGTTCAAAGGTTGCACTGGTTGGTCCAAGTGGTGGTGGAAAGACTACAATA
GCAAATTTGATAGAGAGATTCTATGATCCTGTTAAAGGGAAGATCTTGCTCAATGGGGTTTCTCTGGTTGAAATATCTCATAAGCACCTA
CACCATAAGGTTAGTATAGTGAGCCAGGAACCTGTTCTTTTCAACTGTTCCATCGAAGAAAATATTGCCTATGGATTGGGCGGCAAAGTA
AGCAGTGAAGATATAGAAAAAGCAGCTAAAATGGCTAATGCTCATGAATTTGTATCCAAATTTCCCGAAAAATATCAAACCCATGTCGGA
GAACGAGGATTGAGACTTTCTGGTGGTCAGAAACAGAGAATTGCCATAGCTAGAGCACTGCTGATGAACCCTACAATTTTATTGTTGGAT
GAGGCCACGAGTGCTCTGGATGCTGAAAGTGAATATCTTGTTCAGGATGCCATGGATTCCCTGATGAAAGGTAGAACCGTTCTTGTCATA
GCTCACAGGCTTTCAACAGTCAAGAGCGCGAATACTGTAGCTGTTGTTTCGGATGGTCAAATAGTGGAAAGTGGCACACATGATGACCTT
XCTGAACAAGAATGGGATCTACACAGCACTGGTGAGGAGGCAGTTGCAGGGATACAAATCTGA\(3')TAGCTAGTTTTTATCTTTGTTA
AAAAAAAGCATCTGATAAACTATGTTAGCAAACCACAAATGTTCAATGTACTTGTATTATTCACATATAGAAAGTGTAAGGAGCAGCCAT
CATCATTATTCCATAAATGACAGATTTGTGACAATAAAAAAAAAAAAAAAAAAAACTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan