ESTScan Details for Unigene SGN-U272733

Score 
916
Direction 
Forward
Predicted Peptide Sequence 
MDRKNALWIGFLCIIVAGVGGQAPATSPTTSPAPPTSTTPAPTGSPPPAVSSPPPSVSSPPATSPPATPPPVSAPPVSAPPPATPPPVSA
PPPVSTPPPPAAAPAPVATPPASAPAPTPTTKVATSPAPSPVGLLSPPAPPLGAPSPSGLSPAPSAPDQSGXGGQYEIFKYDYGKFGVWM
GSPLLADLEISM
Predicted Coding Sequence 
ATGGATCGGAAAAATGCTCTTTGGATCGGGTTTCTCTGCATTATCGTCGCTGGTGTAGGGGGTCAAGCTCCTGCCACGTCACCCACCACT
AGTCCCGCACCACCAACATCCACTACCCCTGCACCTACCGGTTCTCCACCTCCTGCAGTAAGTTCACCTCCTCCATCTGTATCTTCTCCA
CCGGCAACTTCACCACCAGCTACTCCTCCACCAGTGAGCGCTCCACCAGTGAGTGCTCCACCACCAGCTACTCCTCCACCAGTGAGTGCT
CCTCCACCTGTGAGTACTCCACCTCCACCGGCAGCGGCACCTGCACCGGTCGCAACTCCACCTGCTTCAGCTCCTGCTCCTACTCCGACT
ACAAAGGTAGCTACATCTCCGGCACCTTCGCCGGTGGGATTGTTGAGTCCTCCAGCACCACCTCTGGGTGCTCCGTCACCGAGTGGTTTA
TCTCCTGCTCCATCAGCCCCTGATCAGAGTGGAGXTGGAGGGCAATATGAGATTTTCAAATATGATTATGGGAAGTTTGGTGTTTGGATG
GGGTCTCCTCTACTTGCTGATTTAGAAATCTCTATGTGA\
Edits in Original Sequence 
CTTCTCTCTTCTAAGAAATTACAACAATTATTTTAGTGTGCAAAACACATTGTGATAAAA(5')ATGGATCGGAAAAATGCTCTTTGGAT
CGGGTTTCTCTGCATTATCGTCGCTGGTGTAGGGGGTCAAGCTCCTGCCACGTCACCCACCACTAGTCCCGCACCACCAACATCCACTAC
CCCTGCACCTACCGGTTCTCCACCTCCTGCAGTAAGTTCACCTCCTCCATCTGTATCTTCTCCACCGGCAACTTCACCACCAGCTACTCC
TCCACCAGTGAGCGCTCCACCAGTGAGTGCTCCACCACCAGCTACTCCTCCACCAGTGAGTGCTCCTCCACCTGTGAGTACTCCACCTCC
ACCGGCAGCGGCACCTGCACCGGTCGCAACTCCACCTGCTTCAGCTCCTGCTCCTACTCCGACTACAAAGGTAGCTACATCTCCGGCACC
TTCGCCGGTGGGATTGTTGAGTCCTCCAGCACCACCTCTGGGTGCTCCGTCACCGAGTGGTTTATCTCCTGCTCCATCAGCCCCTGATCA
GAGTGGAGXTGGAGGGCAATATGAGATTTTCAAATATGATTATGGGAAGTTTGGTGTTTGGATGGGGTCTCCTCTACTTGCTGATTTAGA
AATCTCTATGTGA\(3')TTTTGTGCTCATTTGCTTTTGCCACTATATTTTATATTAATATGAAATGCCATCACTTTAGCTTATTAGTAG
GAGAGGATGATGGCTTTATTTTTCCCACATGTACTTGGATTATATATTCACTTGGATTCTTTTTGGAGGTTTATTGTTGAGGGGAATTTA
TTTTTGTTTTGGGACTTAAACTGCTACTCTATTAGCTAGCTCATCCATTTATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan