ESTScan Details for Unigene SGN-U272822

Score 
317
Direction 
Forward
Predicted Peptide Sequence 
ISLRVFPDPKMATFAARSVLRSATSSARTAATRFAAGAKPKAAPSPFRMPTQKPLAARIFRSPVEMSCAVETMLPYHTATATAVADFNAX
LLLLGVMVGLLKICESCGWY
Predicted Coding Sequence 
XXCATCTCTCTCAGAGTTTTCCCCGATCCGAAAATGGCCACTTTCGCCGCCAGGTCCGTCCTTCGCTCTGCCACTTCCTCCGCCAGAACC
GCTGCCACGAGATTCGCCGCCGGTGCCAAGCCCAAGGCCGCTCCTTCTCCCTTTCGCATGCCCACTCAAAAACCCCTTGCTGCTCGCATT
TTCAGGTCGCCTGTTGAAATGAGTTGTGCAGTGGAAACTATGCTTCCTTATCACACTGCCACAGCTACTGCXGTTGCTGACTTCAATGCT
XCTCTGCTACTCCTCGGAGTTATGGTTGGACTCTTGAAGATTTGTGAATCATGCGGCTGGTATTGA\
Edits in Original Sequence 
(5')XXCATCTCTCTCAGAGTTTTCCCCGATCCGAAAATGGCCACTTTCGCCGCCAGGTCCGTCCTTCGCTCTGCCACTTCCTCCGCCAG
AACCGCTGCCACGAGATTCGCCGCCGGTGCCAAGCCCAAGGCCGCTCCTTCTCCCTTTCGCATGCCCACTCAAAAACCCCTTGCTGCTCG
CATTTTCAGGTCGCCTGTTGAAATGAGTTGTGCAGTGGAAACTATGCTTCCTTATCACACTGCCACAGCTACTGCXGTTGCTGACTTCAA
TGCTXCTCTGCTACTCCTCGGAGTTATGGTTGGACTCTTGAAGATTTGTGAATCATGCGGCTGGTATTGA\(3')TTGTTGATGAGTTAA
TTTCATAATAAGCTTCAAGAAAACTGAATCAGATAGTCTGTGGGACCAAAAGTTGCTTAGATATGAATTTTGAATTTCCAGTTGTAGTTG
TTAAGTTGTCAGCATCATTCTAATACTTGGTGTTTAATCAGATTGCAATGATGATGTATGATGAATGTCAGAGAGTTCAAGCGAAGTTTT
ATACCCATGCAGTCTAAGCAAATGATAAGTAGAGTACTGAATGAGAACTTGGGACTCTTACCTTTCTGTGAATTCTGGCTTCTGTTGGAC
TGTATTTTGGTATCTAGACGTTGGAGTCCTGTGGAAGCTCATTGTTATTAGATTTTGAGAGATGTTTAAAGCCTTAATTTGTCTCAAAAA
TGTTTTTATACAGGCCTTAATAATGTCATCTTTACCCTCTGGTGTTTTATTGACCAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan