ESTScan Details for Unigene SGN-U272895

Score 
958
Direction 
Forward
Predicted Peptide Sequence 
GNLSVPNPEFFFPNNSPPNNNNKRSSSHIIAVITAVAVISGIALLSILCFLIFRRWKRGKELHTSVTKSSWIPLSITSTQPKEPAAQAHR
ATIRSVPTLFTEEIKTATCNFDEKFVIGYGGFGNVYKGYIDNGATIVAVKRLNPSSKQGXPRVRNRDSHVVKAKACASGSLIGYCDDNNE
MILVYDYMSHGTLRDHLYKTDNAPLPWKKRLEICIGAAKGLHYLHTGKKDIIIHRDVKSTNILLDDKWVAKVSDFGLSKIGPLSGSGKTH
VSTVVKGSFGYLDPEYYKRQQLTEKSDXVFFWGGAIRSVVPRPALIPNMPKGQVNLADWACRSCKKGNLQQIIDPNLEGQIAPECLNKFA
EAAYNCLKDQGVQRPSMNDVVWNLEFILKLQDAADNRGHKMELNSYPTSPSFPLIMNDNTNISTDEGFEAFSGSHEVGGKYTSSATSMTS
NSDDKLKSDTIFSEILNPSGR
Predicted Coding Sequence 
GGAAACCTCTCCGTGCCGAATCCTGAATTTTTCTTTCCGAATAATTCACCACCAAACAACAATAATAAGAGATCATCATCACACATCATT
GCTGTTATCACTGCAGTGGCTGTTATTAGCGGAATTGCTCTGCTTTCAATTCTCTGTTTCTTAATTTTCCGGCGGTGGAAAAGGGGAAAA
GAACTTCATACAAGCGTTACAAAGTCATCATGGATCCCTTTGTCAATTACATCAACTCAACCCAAAGAACCGGCGGCTCAGGCTCATCGC
GCTACCATCCGATCTGTGCCGACACTTTTTACTGAAGAGATAAAAACAGCAACATGCAATTTTGATGAAAAATTTGTGATTGGCTATGGA
GGTTTTGGTAATGTATACAAAGGGTACATAGACAACGGCGCAACCATAGTTGCAGTCAAGAGATTGAATCCTTCATCAAAGCAAGGAGXT
CCACGAGTTCGAAACAGAGATTCACATGTTGTCAAAGCTAAGGCATGTGCATCTGGTTCCTTAATTGGTTATTGTGATGATAACAATGAG
ATGATCTTGGTTTATGATTACATGTCTCATGGAACTCTTCGTGATCACTTGTACAAAACTGATAATGCTCCACTTCCATGGAAGAAACGC
CTTGAGATTTGCATTGGCGCAGCAAAAGGATTGCATTATCTCCATACAGGTAAAAAGGATATCATTATTCATCGAGATGTGAAGTCAACC
AACATTTTATTGGATGATAAATGGGTTGCTAAGGTTTCAGATTTTGGGTTATCCAAAATCGGTCCACTTAGTGGATCAGGGAAAACCCAT
GTTAGCACTGTTGTGAAAGGAAGCTTTGGATATCTAGATCCTGAATACTATAAGCGACAACAATTGACAGAAAAATCTGATGXTGTATTC
TTTTGGGGTGGTGCTATTCGAAGTGTTGTGCCTAGACCAGCATTAATTCCTAACATGCCGAAAGGGCAAGTGAATTTGGCTGATTGGGCT
TGTAGGAGCTGTAAAAAAGGAAATCTTCAACAAATAATTGATCCGAATTTGGAAGGGCAAATTGCGCCAGAGTGCTTAAACAAGTTTGCA
GAAGCAGCATATAATTGCTTGAAGGATCAAGGAGTCCAAAGGCCATCAATGAATGACGTTGTCTGGAATTTGGAATTTATATTAAAGCTT
CAAGATGCAGCTGATAATAGAGGTCACAAAATGGAATTGAACAGTTATCCGACTAGCCCGTCTTTCCCCTTGATTATGAATGATAATACC
AATATATCTACAGATGAAGGATTCGAGGCATTTTCAGGTTCACATGAAGTTGGAGGAAAATACACAAGCAGTGCTACATCCATGACCAGT
AATAGTGATGACAAATTGAAGAGTGACACTATTTTCTCTGAGATTTTGAATCCATCGGGTCGATGA\
Edits in Original Sequence 
(5')GGAAACCTCTCCGTGCCGAATCCTGAATTTTTCTTTCCGAATAATTCACCACCAAACAACAATAATAAGAGATCATCATCACACAT
CATTGCTGTTATCACTGCAGTGGCTGTTATTAGCGGAATTGCTCTGCTTTCAATTCTCTGTTTCTTAATTTTCCGGCGGTGGAAAAGGGG
AAAAGAACTTCATACAAGCGTTACAAAGTCATCATGGATCCCTTTGTCAATTACATCgAACTCAACCCAAAGAACCGGCGGCTCAGGCTC
ATCaGCGCTACCATCCGATCTGTGCCGACACTTTTTACTaGAAGAGATAAAAACAGCAACATGCAATTTTGATGAAAAATTTGTGATTGG
CTATGGAGGTTTTGGTAATGTATACAAAGGGTACATAGACAACGGCGCAACCATAGTTGCAGTCAAGAGATTGAATCCTTCATCAAAGCA
AGGAGXTCCACGAGTTCGAAACAGAGATTCACATGTTGTCAAAGCTAAGGCATGTGCATCTGGTaTCCTTAATTGGTTATTGTGATGATA
ACAATGAGATGATCTTGGTTTATGATTACATGTCTCATGGAACTCTTCGTGATCACTTGTACAAAACTGATAATGCTCCACTTCCATGGA
AGAAACGCCTTGAGATTTGCATTGGCGCAGCAAAAGGATTGCATTATCTCCATACAGGTAAAAAGGATATCATTATTCATCGAGATGTGA
AGTCAACCAACATTTTATTGGATGATAAATGGGTTGCTAAGGTTTCAGATTTTGGGTTATCCAAAATCGGTCCACTTAGTGGATCAGGGA
AAACCCATGTTAGCACTGTTGTGAAAGGAAGCTTTGGATATCTAGATCCTGAATACTATAAGCGACAACAATTGACAGAAAAATCTGATG
XTGTATTCTTTTGGGGTGGTGCTATTCGAAGTGTTGTGCgCTAGACCAGCATTAATTCCTAACATGCCGAAAGGGCAAGTGAATTTGGCT
GATTGGGCTTGTAGGAGCTGTAAAAAAGGAAATCTTCAACAAATAATTGATCCGAATTTGGAAGGGCAAATTGCGCCAGAGTGCTTAAAC
AAGTTTGCAGAAGCAGCATATAATTGCTTGAAGGATCAAGGAGTCCAAAGGCCATCAATGAATGACGTTGTCTGGAATTTGGAATTTATA
TTAAAGCTTCAAGATGCAGCTGATAATAGAGGTCACAAAATGGAATTGAACAGTTATCCGACTAGCCCGTCTTTCCCCTTGATTATGAAT
GATAATACCAATATATCTACAGATGAAGGATTCGAGGCATTTTCAGGTTCACATGAAGTTGGAGGAAAATACACAAGCAGTGCTACATCC
ATGACCAGTAATAGTGATGACAAATTGAAGAGTGACACTATTTTCTCTGAGATTTTGAATCCATCGGGTCGATGA\(3')GATTGTTACA
ACTAGTATGATAAATTACATATTAGTTCTTCTCTGTTTTTTTTTTCCTTTGTTGAATTTATGTCCTTATTATATATGTAGATGAATTGAA
GCCATTATTCAGAAGTATATAAGCTATAAAATAGTTTCACTAAAAAAAAAAAAAAAAAAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan