ESTScan Details for Unigene SGN-U272947

Score 
597
Direction 
Forward
Predicted Peptide Sequence 
MDGWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTALVGCSQTQIAIYEASKLECVKQWVSPNFAVTDATYSCDSQSIFASFDDGSVSIF
TAAALKLRCRVNPAAYLPSNPSSRVYPLVVAAHPSESNQCAVGLTDGGVYVLEPLESEGKWGTPPPNENGVAPGMSSATAGLDQAIKVAV
CSGLSDANAPVLIFGGSCRFSDLGYNLLTPVIRSLAVSPVEADTVWKISIQLKEGFKKRQNVDNYGRLGIQFNLREILPVKLFLFKH
Predicted Coding Sequence 
ATGGATGGATGGGAGAAGAAAGCTAGCAAGTTTTTGCAGATCCCCTCTGGTAGAGCAATAAATCCTCTTGCTCAGACACGAGTTCAGTTC
CATCAAGATCAGACXGCACTTGTTGGTTGTTCACAAACACAGATAGCAATATATGAAGCATCAAAGCTTGAATGCGTGAAGCAGTGGGTT
TCACCAAATTTTGCAGTTACTGATGCGACGTACTCGTGTGATAGCCAATCAATTTTTGCAAGTTTTGATGATGGAAGTGTGAGTATCTTT
ACTGCTGCAGCACTCAAGCTGAGGTGTCGGGTGAATCCTGCCGCCTACTTGCCTTCTAACCCAAGCTCCAGAGTATATCCACTTGTCGTT
GCTGCTCATCCATCTGAATCAAACCAATGCGCAGTAGGACTTACTGATGGTGGAGTTTATGTGCTTGAGCCTCTAGAGTCGGAAGGTAAA
TGGGGTACACCTCCTCCAAATGAAAATGGTGTTGCCCCTGGCATGAGCTCTGCTACCGCTGGTCTTGATCAAGCXATCAAGGTAGCGGTC
TGCAGTGGCCTCTCTGATGCAAATGCTCCTGTGCTTATTTTCGGTGGGAGCTGTAGATTTTCAGATCTAGGATACAACCTCTTGACGCCA
GTGATAAGAAGTTTGGCAGTGTCTCCTGTGGAAGCAGATACAGTATGGAAGATCAGTATTCAGTTAAAAGAAGGATTCAAAAAAAGACAA
AATGTTGATAATTATGGTAGATTAGGGATTCAGTTCAACCTCCGAGAAATTTTGCCTGTTAAGTTGTTTCTGTTCAAGCACTAA\
Edits in Original Sequence 
TAAATTCCATGTTATACTTAGAATAACTGCAGGACCCAGATTTACTGTTGGGACTTGCTCAATGCTTTTTTGGTAGACACTTGAGAAATT
TAAGTGGGTAATAGAGTGTAGAATTTCTTATAAACAGCAAAAAAGCTTTCTACCTTGTCATCAAGTTGCTTTCTATTGCACTTATTACCT
GATTATGGCAGGAAAGTTAAAACACAACAGTTCCCTTCCAAAGTGTTTCCATTGATTTCTCCAGAGAATTTCCATCCTGTAATTTTATTG
GAGCGCAGCATTAGTAGTGTGGACTGATATCTCTCTTTATCTTGGTTTCTTACCTTTTACATTCTTCAGCTATGTGTTTGGAGC
(5')AT
GGATGGATGGGAGAAGAAAGCTAGCAAGTTTTTGCAGATCCCCTCTGGTAGAGCAATAAATCCTCTTGCTCAGACACGAGTTCAGTTCCA
TCAAGATCAGACXGCACTTGTTGGTTGTTCACgAAACACAGATAGCAATATATGAAGCATCAAAGCTTGAATGCGTGAAGCAGTGGGTTT
CACCAAATTTTGCAGTTACTGATGCGACGTACTCGTGTGATAGCCAATCAATTTTTGCAAGTTTTGATGATGGAAGTGTGAGTATCTTTA
CTGCTGCAGCACTCAAGCTGAGGTGTCGGGTGAATCCTGCCGCCTACTTGCCTTCTAACCCAAGCTCCAGAGTATATCCACTTGTCGTTG
CTGCTCATCCATCTGAATCAAACCAATGCGCAGTAGGACTTACTGATGGTGGAGTTTATGTGCTTGAGCCTCTAGAGTCGGAAGGTAAAT
GGGGTACACCTCCTCCAAATGAAAATGGTGTTGCCCCTGGCATGAGCTCTGCTACCGCTGGTCTTGATCAAGCXATCAAGGTAGCGGTCT
GCAGTGGCCTCTCTGATGCAAATGCTCCTGTGCTaTATTTTCGGTGGGAGCTGTAGATTTTCAGATCTAGGATACAACCTCTTGACGCCA
GTGATAAGAAGTTTGGCAGTGTCTCCTGTGGAAGCAGATACAGTATGGAAGATCAGTATTCAGTTAAAAGAAGGATTCAAAAAAAGACAA
AATGTTGATAATTATaGGTAGATTAGGGATTCAGTTCAACCTCCGAGAAATTTTGCCTGTTAAGTTGTTTCTGTTCAAGCACTAA\(3')
ACTATGGCAGTGTAATTATTAAGAGCTCAAGCAAGTCAGTTGTTTTCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan