ESTScan Details for Unigene SGN-U273003

Score 
907
Direction 
Forward
Predicted Peptide Sequence 
IAGHISLVFLIFPSLLTASIFFKCSVPPYPSKTSNPINPKLQFLKSIQKVPFFHSWGXINFNPFNNNWFNKPSTPFQPINLLSHFDSLKP
HQHSPPFAAISNPFSRKPKTPPEKPGXLPENAGPVLLGMETRPDFRHAPKVERIMNEDPIFEKKENPTKEEIEENEKWFAELRESPVVQF
LLQAEEIADKINDLELQENSAPFRKEDKKLWQAVPNVIGLDGRPMPRKAIKTKKESDDKFWDFARQFFFGLWGFRQRPYPPGRPIDAAQA
IGYKRLEKRYHDFIMRSGGWFYKDRLGRSRGPMELIQLKTAWGSGIIDKHTFIWGEDMDEWAPIGMVYGLEKAIATWEGLSLQVMLTTYQ
DYSAYELVFQHKLIRKERFSRNPGILKHMLISI
Predicted Coding Sequence 
ATTGCCGGCCACATCTCCCTTGTCTTCCTCATCTTCCCTTCACTCCTCACAGCTTCTATCTTTTTCAAATGCTCTGTTCCTCCGTATCCA
TCTAAAACCTCAAACCCCATAAACCCTAAACTTCAATTTCTAAAATCTATCCAGAAAGTTCCATTTTTTCATTCATGGGGTXCAATCAAT
TTCAACCCATTCAACAATAACTGGTTCAACAAACCTTCAACACCATTTCAACCAATTAATCTTCTATCCCACTTTGATTCCCTAAAGCCC
CATCAACATTCTCCGCCTTTTGCAGCTATTTCAAATCCATTTTCAAGAAAACCCAAAACACCTCCTGAAAAACCAGGTXCATTACCGGAA
AATGCTGGACCAGTTCTATTGGGAATGGAGACCCGACCCGACTTTCGACATGCTCCGAAAGTTGAGCGGATTATGAATGAGGATCCGATT
TTTGAGAAAAAGGAGAACCCAACTAAGGAAGAGATTGAGGAGAATGAGAAGTGGTTCGCTGAGTTACGGGAAAGCCCAGTGGTTCAGTTT
TTGCTCCAAGCTGAAGAGATTGCTGATAAAATCAATGACCTTGAGCTTCAAGAGAATTCAGCTCCATTTCGAAAGGAAGATAAGAAACTG
TGGCAGGCAGTGCCAAATGTCATTGGATTGGATGGGAGGCCAATGCCCAGAAAGGCCATAAAGACAAAGAAGGAATCAGATGATAAATTT
TGGGATTTTGCAAGGCAGTTCTTTTTTGGGCTTTGGGGATTTCGTCAACGACCATACCCACCTGGAAGGCCCATTGATGCTGCACAGGCT
ATTGGATACAAAAGGCTTGAAAAGCGATATCATGATTTTATTATGAGAAGCGGTGGGTGGTTCTACAAGGATCGATTAGGTCGTTCGAGG
GGACCTATGGAATTGATACAGCTTAAGACTGCTTGGGGTTCAGGAATCATTGATAAGCACACCTTCATTTGGGGTGAGGATATGGATGAA
TGGGCTCCCATCGGAATGGTATATGGTCTGGAAAAAGCAATTGCCACTTGGGAAGGTTTGTCTTTGCAAGTAATGCTCACAACATATCAA
GATTACTCTGCATATGAGCTAGTTTTTCAACATAAATTAATCAGAAAAGAGAGGTTTTCTAGAAACCCTGGCATTCTGAAGCATATGCTC
ATATCAATTTAA\
Edits in Original Sequence 
(5')ATTGCCGGCCACATCTCCCTTGTCTTCCTCATCTTCCCTgTCACTCCTCACAGCTTCTATCTTTTTCAAATGCTCTGTTCCTCCGT
ATCCATCTAAAACCTCAAACCCCATAAACCCTAAACTTCAATTTCTAAAATCTATCCAGAAAGTTCCATTTTTTCATTCATGGGGTXCAA
TCAATTTCAACCCATTCAACAATAACTGGTTCAACAAACCTTCAACACCATTTCAACCAATTAATCTTCTATCCCACTTTGATTCCCTAA
AGCCCCATCAACATTCTCCGCCTTTTGCAGCTATTTCAAATCCATTTTCAAGAAAACCCAAAACACCTCCTGAAAAACCAGGTXCATTAC
CGGAAAATGCTGGACCAGTTCTATTGGGAATGtGAGACCCGACCCGACTTTCGACATGCTCCGAAAGTTGAGCGGATTATGAATGAGGAT
CCGATTTTTGAGAAAAAGGAGAACCCAACTAAGGAAGAGATTGAGGAGAATGAGAAGTGGTTCGCTGAGTTACGGGAAAGCCCAGTGGTT
CAGTTTTTGCTCCAAGCTGAAGAGATTGCTGATAAAATCAATGACCTTGAGCTTCAAGAGAATTCAGCTCCATTTCGAAAGGAAGATAAG
AAACTGTGGCAGGCAGTGCCAAATGTCATTGGATTGGATGGGAGGCCAATGCCCAGAAAGGCCATAAAGACAAAGAAGGAATCAGATGAT
AAATTTTGGGATTTTGCAAGGCAGTTCTTTTTTGGGCTTTGGGGATTTCGTCAACGACCATACCCACCTGGAAGGCCCATTGATGCTGCA
CAGGCTATTGGATACAAAAGGCTTGAAAAGCGATATCATGATTTTATTATGAGAAGCGGTGGGTGGTTCTACAAGGATCGATTAGGTCGT
TCGAGGGGACCTATGGAATTGATACAGCTTAAGACTGCTTGGGGTTCAGGAATCATTGATAAGCACACCTTCATTTGGGGTGAGGATATG
GATGAATGGGCTCCCATCGGAATGGTATATGGTCTGGAAAAAGCAATTGCCACTTGGGAAGGTTTGTCTTTGCAAGTAATGCTCACAACA
TATCAAGATTACTCTGCATATGAGCTAGTTTTTCAACATAAATTAATCAGAAAAGAGAGGTTTTCTAGAAACCCTGGCATTCTGAAGCAT
ATGCTCATATCAATTTAA\(3')TCAGTAAAACATAAATTATTCCCAGCAAGCATTTTAAATTTTTTTCGTATTCGTCTTCAGATGTTTG
TCACCATGCTATGTTACCTTTGTGCTTATTCTGTAGTTCTTGTATTTGGTTTTGTTTCTCTCATTCCATGGAGGTTGAGGTCCATGTTGT
CATATGATTGATCCCTTGCATTTATTTGGCTGAAGTGCAGTTAGACTAGGTGCTGCTGCTACTGCTCTCCTTCACAAACTACAGAAGGGT
ATACCTCCTTGGGTTCCTCTCAGAGGACATGAGCCGAAGACATATAAGCAGATGCAAGAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan