ESTScan Details for Unigene SGN-U273010

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
VHPKALKNTKQTPLFLSRELDRDYGFTPILIVFFHSQESLNLYSEQKKGNXLIXNPINPIEAKIRLKEVEVELKAKAESAQNRVVGVVGI
SAMHRVASAGNTSNSVRPRKEKRLTYVLNDADDTKHCAGVNSLAVLKSPATDGCEYLFTGSRDGTLKRWALAEDGATCSATFESHVDWVN
DAVLTGSNTLVSCSSDTTVKVWNGLSEGSCIKTLRQHSDYVTSLASAEKNSNVIASAGLGGEVFIWDLEAALTPTSKSGDATEEDCSX
Predicted Coding Sequence 
GTTCATCCCAAAGCATTGAAAAACACCAAACAAACACCTCTCTTTCTCTCTCGCGAACTCGATAGAGACTACGGTTTTACACCGATACTT
ATAGTCTTCTTTCACTCTCAAGAATCGCTGAATCTCTACAGCGAGCAGAAGAAGGGTAATCXGCTAATTGAXAATCCTATAAACCCAATT
GAGGCGAAAATAAGGTTGAAAGAAGTTGAGGTTGAGCTTAAAGCTAAGGCTGAATCTGCTCAGAATAGAGTTGTTGGAGTTGTTGGGATT
TCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGGTTCGGCCTAGGAAGGAGAAGAGGTTGACTTATGTTTTGAATGAT
GCAGATGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTATTGAAGTCACCAGCAACCGATGGATGTGAATACCTATTTACTGGG
AGTAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTCTGCCACATTTGAGTCACATGTCGATTGGGTTAAT
GATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAGACACCACTGTCAAGGTGTGGAATGGCTTATCTGAGGGATCTTGT
ATTAAGACACTCCGGCAGCACTCCGATTACGTCACCAGCCTTGCTTCAGCAGAAAAAAATAGCAATGTTATTGCATCTGCTGGTCTTGGT
GGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACATCTAAGTCCGGTGATGCCACCGAAGAAGACTGTTCAAAX\
Edits in Original Sequence 
(5')GTTCATCCCAAAGCATTGAAAAACACCAAACAAACACCTCTCTTTCTCTCTCGCGAACTCGATAGAGACTACGGTTTTACACCGAT
ACTTATAGTCTTCTTTCACTCTCAAGAATCGCTGAATCTCTACAGCGAGCAGAAGAAGGGTAATCXGCTAATTGAXAATCCTATAAACCC
AATTGAGGCGAAAATAAGGTTGAAAGAAGTTGAGGTTGAGCTTAAAtGCTAAGGCTaGAATCTGCTCAGAATAGAGTTGTTGtGAGTTGT
TGGGATTTCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGGTTCGGCCTAGGAAGGAGAAGAGGTTGACTTATGTTTT
GAATGATGCAGATGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTATTGAAGTCACCAGCAACCGATGGATGTGAATACCTATT
TACTGGGAGTAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTCTGCCACATTTGAGTCACATGTCGATTG
GGTTAATGATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAGACACCACTGTCAAGGTGTGGAATGGCTTATCTGAGGG
ATCTTGTATTAAGACACTCCGGCAGCACTCCGATTACGTCACCAGCCTTGCTTCAGCAGAAAAAAATAGCAATGTTATTGCATCTGCTGG
TCTTGGTGGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACATCTAAGTCCGGTGATGCCACCGAAGAAGACTGTTCAAA
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan