ESTScan Details for Unigene SGN-U273011

Score 
538
Direction 
Forward
Predicted Peptide Sequence 
LFCFHFPTVSTAKINGILASEGFVLTEIRCFXALLMTDICNAPVASAGNTSTSVRARKEKRLTYVLNDTHDTKHCAGVNCLALLKSSSPG
GSEYLFTGSRDGTLKRWALAEDGATCCATFESHVDWVNDAVLTGNNTLVSCSSDTTVKDGMAYLRDLVPGRLVSTXDYVTCLASAEKNSN
VVASAGLGGEVYIWDLEGALSPTSKSSDATEENCSNGVSGAGSSLSITSIHPNSLSNTISLHTQSQGYIPVSAKGHKESVYALAMNDSGS
L
Predicted Coding Sequence 
XCTTTATTCTGCTTTCATTTCCCAACTGTCTCAACCGCGAAGATAAATGGAATTTTAGCAAGTGAAGGGTTTGTGCTGACTGAAATCCGC
TGCTTTGXTGCACTTTTGATGACGGATATCTGCAATGCACCTGTAGCTAGTGCAGGCAACACGTCCACTTCTGTGCGGGCTCGCAAGGAG
AAGAGGTTGACTTATGTCTTAAATGACACCCATGACACTAAGCATTGTGCTGGTGTAAATTGCTTGGCTTTGTTGAAGTCGTCCTCACCC
GGTGGGTCTGAGTACCTATTTACCGGGAGCAGAGATGGCACTTTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTGTGCTACA
TTTGAATCCCATGTTGATTGGGTAAATGACGCTGTTCTTACAGGCAATAACACATTGGTTTCATGCTCCTCAGACACCACTGTCAAGGAT
GGAATGGCTTATCTGAGGGATCTTGTACCAGGACGCTTAGTCAGCACTXCTGATTATGTCACTTGCCTTGCTTCAGCAGAAAAAAATAGC
AATGTTGTTGCATCTGCTGGCCTTGGTGGTGAGGTTTACATATGGGACCTTGAAGGTGCACTTTCCCCAACATCTAAGTCAAGTGATGCA
ACTGAGGAAAACTGTTCAAATGGTGTCAGTGGTGCAGGAAGTTCACTGTCCATTACAAGCATCCACCCTAATAGTTTGAGCAACACCATT
TCCTTGCACACCCAGTCCCAAGGATATATTCCTGTGTCTGCAAAAGGCCATAAGGAGTCAGTATATGCATTGGCAATGAATGACAGTGGA
TCCCTX\
Edits in Original Sequence 
(5')XCTTTATTCTGCTTTCATTTCCCAACTGTCTCAACCGCGAAGATAAATGGAATTTTAGCAAGTGAAGGGTTTGTGCTGACTGAAAT
CCGCTGCTTTGXTGCACTTTTGATGACGGATATCTGCAATGCACCgTGTAGCTAGTGCAGGCAACACGTCCACTTCTGTGCGGGCTCGCA
AGGAGAAGAGGTTGACTTATGTCTTAAATGACACCCATGACACTAAGCATTGTGCTGGTGTAAATTGCTTGGCTTTGTTGAAGTCGTCCT
CACCCGGTGGGTCTGAGTACCTATTTACCGGGAGCAGAGATGGCACTTTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTGTG
CTACATTTGAATCCCATGTTGATTGGGTAAATGACGCTGTTCTTACAGGCAATAACACATTGGTTTCATGCTCCTCAGACACCACTGTCA
AGGtATGGAATGGCTTATCTGAGGGATCTTGTACCAGGACGCTTAGTCAGCACTXCTGATTATGTCACTTGCCTTGCTTCAGCAGAAAAA
AATAGCAATGTTGTTGCATCTGCTGGCCTTGGTGGTGAGGTTTACATATGGGACCTTGAAGGTGCACTTTCCCCAACATCTAAGTCAAGT
GATGCAACTGAGGAAAACTGTTCAAATGGTGTCAGTGGTGCAGGAAGTTCACTGTCCATTACAAGCATCCACCCTAATAGTTTGAGCAAC
ACCATTTCCTTGCACACCCAGTCCCAAGGATATATTCCTGTGTCTGCAAAAGGCCATAAGGAGTCAGTATATGCATTGGCAATGAATGAC
AGTGGATCCCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan