ESTScan Details for Unigene SGN-U273198

Score 
520
Direction 
Forward
Predicted Peptide Sequence 
EVYDYPDPEFSVFDKHKAQNCFAIDQIWACYDTADGMPRFYAHIRKVYSPEFKVMFSWLDAYPEDQRGRAWVGAELPVGCGKFRRGSTES
TSDRLTFSHQLQWEWAREACTLYIQGKEKRGALFKDWDISWSSDPDNHRKYKYEIVEILSDYVVDVGVLVGYLDKVSRFVSLFQRMRPTE
VGTFFVKPNELYKFSHQIPSFKMTGTETERVYLAGSFELDPASLPLNPDDIWYPGKVWKTAXAANSEHVENX
Predicted Coding Sequence 
XCAGAGGTGTATGATTATCCTGACCCTGAATTTAGTGTTTTTGACAAGCATAAAGCACAAAATTGCTTTGCAATTGATCAGATCTGGGCT
TGCTATGATACGGCTGATGGTATGCCAAGATTCTATGCCCACATTAGGAAGGTATACAGTCCTGAATTTAAGGTGATGTTCAGTTGGCTT
GATGCTTATCCAGAAGATCAAAGGGGCAGAGCTTGGGTCGGGGCAGAGTTGCCTGTTGGCTGTGGGAAATTTAGACGTGGAAGTACTGAA
TCCACTTCTGATCGACTTACATTTTCTCATCAACTGCAGTGGGAATGGGCAAGAGAGGCCTGTACATTGTATATCCAAGGAAAGGAGAAA
CGTGGXGCCCTTTTCAAAGATTGGGATATTAGTTGGAGCTCTGATCCAGATAATCATAGGAAGTACAAGTATGAAATCGTGGAGATACTT
TCTGATTATGTTGTGGATGTTGGTGTCCTAGTTGGTTATTTAGATAAAGTTTCCAGATTTGTTAGCCTTTTCCAGCGAATGAGGCCAACT
GAAGTTGGTACATTCTTTGTAAAGCCAAATGAACTTTACAAGTTCTCTCATCAAATTCCTTCTTTTAAAATGACTGGAACTGAAACXGAG
AGGGTGTACCTNGCGGGATCCTTTGAACTTGATCCTGCTTCTTTACCCCTCAATCCTGATGATATTTGGTACCCTGGAAAAGTATGGAAA
ACAGCAGXGGCTGCTAATTCTGAACATGTAGAAAATGXX\
Edits in Original Sequence 
(5')XCAGAGGTGTATGATTATCCTGACCCTGAATTTAGTGTTTTTGACAAGCATAAAGCACAAAATTGCTTTGCAATTGATCAGATCTG
GGCTTGCTATGATACGGCTGATGGTATGCCAAGATTCTATGCCCACATTAGGAAGGTATACAGTCCTGAATTTAAGGTGATGTTCAGTTG
GCTTGATGCTTATCCAGAAGATCAAAGGGGCAGAGCTTGGGTCGGGGCAGAGTTGCCTGTTGGCTGTGGGAAATTTAGACGTGGAAGTAC
TGAATCCACTTCTGATCGACTTACATTTTCTCATCAACTGCAGTGcGGAATGGGCAAGAGAGGCCTGTACATTGTATATCCAAGGAAAGG
AGAAACGTGGXGCCCTTTTCAAAGATTGGGATATTAGTTGGAGCTCTGATCCAGATAATCATAGGAAGTACAAGTATGAAATCGTGGAGA
TACTTTCTGATTATGTTGTGGATGTTGGTGTCCTAGTTGGTTATTTAGATAAAGTTTCCAGATTTGTTAGCCTTTTCCAGCGAATGAGGC
CAACTGAAGTTGGTACATTCTTTGTAAAGCCAAATGAACTTTACAAGTTCTCTCATCAAATTCCTTCTTTTAAAATGACTGGAACTGAAA
CXGAGAGGGTGTACCTNGCGGGATCCTTTGAACTTGATCCTGCTTCTTTACCCCTCAATCCTGATGATATTTGGTACCCTGGAAAAGTAT
GGAAAACAGCAGXGGCTGCTAATTCTGAACATGTAGAAAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan