ESTScan Details for Unigene SGN-U273261

Score 
1293
Direction 
Forward
Predicted Peptide Sequence 
MGSPCYSACTIQSLNPTCPSSSSSSVIFALHKPQIHSNIIQNYTRRRIITCSSNSRRRMASVAAMNVGSSSVEVGIQNQQELKKGIADLY
DESSGIWEDIWGDHMHHGYYEPQSSVELSDHRAAQIRMIEKALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQ
AERAQALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGTIILVTWCHRDLSPSEESLTPEEKEL
LNKICKAFYLPAWCSAADYVKLLQSNSLQDIKAEDWSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAI
ITCRKPE
Predicted Coding Sequence 
ATGGGCAGCCCATGCTATTCCGCTTGTACTATCCAATCATTGAACCCCACGTGTCCTTCATCTTCTTCCTCCTCTGTTATCTTCGCTCTT
CATAAACCCCAGATTCACAGTAATATTATTCAAAATTATACTAGGAGAAGAATCATTACTTGTAGTAGTAATAGTAGAAGAAGAATGGCT
AGTGTTGCTGCGATGAATGTTGGGTCTTCATCAGTAGAAGTTGGAATACAGAATCAACAAGAGTTGAAAAAAGGAATTGCAGATTTATAT
GATGAGTCTTCTGGGATTTGGGAAGATATTTGGGGTGACCATATGCATCATGGATATTATGAACCTCAGTCATCTGTGGAACTTTCTGAT
CATCGTGCTGCTCAGATCCGTATGATTGAAAAGGCGCTAAGTTTTGCTGCTATTTCTGAAGATCCAGCGAAGAAACCAACGTCCATAGTT
GATGTTGGATGTGGCATTGGTGGCAGTTCTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTACAA
GCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGGGATAAGGTTTCATTTCAAGTAGCAGACGCCTTGAATCAGCCTTTTCCA
GATGGGCAATTCGACTTGGTTTGGTCCATGGAGAGTGGAGAACACATGCCAAACAAAGAAAAGTTTGTTGGCGAATTAGCTAGAGTGGCA
GCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCAGAGGAATCTCTGACTCCAGAGGAAAAAGAGCTG
CTAAATAAGATATGTAAAGCCTTCTATCTTCCGGCATGGTGTTCCGCTGCTGATTATGTGAAGTTACTTCAATCCAACTCTCTTCAGGAT
ATTAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGTCAGCACTGACATGGAAGGGCTTCACATCAGTA
CTACGCAGTGGATGGAAGACAATCAAAGCTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCATC
ATCACATGTCGAAAACCTGAATAA\
Edits in Original Sequence 
AATAAATAAACAAACAATTATTAGCTCATTGTTTCTCCTTCTTTCATTGCTTCAACTGTCCCCTAAATTATATCTATAGATAGTATATAG
TAATAAATCATA
(5')ATGGGCAGCCCATGCTATTCCGCTTGTACTATCCAATCATTGAACCCCACGTGTCCTTCATCTTCTTCCTCCTC
TGTTATCTTCGCTCTTCATAAACCCCAGATTCACAGTAATATTATTCAAAATTATACTAGGAGAAGAATCATTACTTGTAGTAGTAATAG
TAGAAGAAGAATGGCTAGTGTTGCTGCGATGAATGTTGGGTCTTCATCAGTAGAAGTTGGAATACAGAATCAACAAGAGTTGAAAAAAGG
AATTGCAGATTTATATGATGAGTCTTCTGGGATTTGGGAAGATATTTGGGGTGACCATATGCATCATGGATATTATGAACCTCAGTCATC
TGTGGAACTTTCTGATCATCGTGCTGCTCAGATCCGTATGATTGAAAAGGCGCTAAGTTTTGCTGCTATTTCTGAAGATCCAGCGAAGAA
ACCAACGTCCATAGTTGATGTTGGATGTGGCATTGGTGGCAGTTCTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCAC
TTTGAGTCCTGTACAAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGGGATAAGGTTTCATTTCAAGTAGCAGACGCCTT
GAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCCATGGAGAGTGGAGAACACATGCCAAACAAAGAAAAGTTTGTTGGCGA
ATTAGCTAGAGTGGCAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCAGAGGAATCTCTGACTCC
AGAGGAAAAAGAGCTGCTAAATAAGATATGTAAAGCCTTCTATCTTCCGGCATGGTGTTCCGCTGCTGATTATGTGAAGTTACTTCAATC
CAACTCTCTTCAGGATATTAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGTCAGCACTGACATGGAA
GGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAGCTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCT
CATCAAATTTGCCATCATCACATGTCGAAAACCTGAATAA\(3')TTCTTCGCGTAGCTACTGATTAATAAACATCTATGGATCTTGGAA
GAAACATAAACTATTTATTAGGTACAGAAAATGCAACATTGAATGAACTCTGGATTGCAAGCTGAAGAAATTGCCACATTTGCTACAATA
GCTTTAATAATCCATTTAACATGTTGTAGTGTGAAATTGCCACATTGTACTGTACCAATCATCAAAAGAGTATCAAGGTATCTAGTTCTA
AGAAGAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan