ESTScan Details for Unigene SGN-U273272

Score 
709
Direction 
Forward
Predicted Peptide Sequence 
SEAASRLMKLVHGTLKDVCLSSSRVGLEFYHAARDSLLLYEAIIHVKFERQLDSINHSAVLIHNDCHYLSQEILGLAFEYRSDFPASMKE
LVVFANLASRFQMLAEEVFQRQIKLVIYNLKQAIDEADGFQNTHQMKQYESAKLSIDPGDFQLEKVYIXMAPFTPTFCIQEKYEHGAGGS
LFRIANDILLLDDIAAEEXIAAPKADSSAIRESSSFLDSVLAINQTGKLQESPAQTLDDLIPSLRKLRKLADLLDMPLKSITAAWETDEL
ANHGFKQSEVEDFIRAIFADSPLRKDAYEE
Predicted Coding Sequence 
XXGTCTGAAGCAGCGTCACGACTAATGAAGTTAGTTCATGGAACACTCAAGGATGTTTGCCTGTCATCTTCTAGAGTGGGGTTGGAATTC
TATCACGCTGCTCGGGATTCTCTACTTCTTTATGAAGCTATCATACATGTTAAGTTCGAAAGGCAGCTTGATTCCATCAACCATTCTGCC
GTTCTTATTCACAATGATTGCCACTATCTCTCTCAGGAGATTCTTGGACTTGCATTTGAGTACCGCTCAGACTTTCCAGCTTCAATGAAG
GAACTTGTTGTATTTGCGAATTTGGCTTCAAGATTCCAGATGCTTGCAGAAGAAGTTTTTCAAAGACAAATTAAACTTGTCATTTACAAC
CTAAAACAGGCTATTGATGAAGCCGATGGATTTCAAAATACTCATCAAATGAAGCAATATGAATCTGCTAAGTTGAGCATTGACCCAGGT
GATTTTCAACTTGAGAAAGTATATATTXATATGGCACCGTTTACTCCTACCTTCTGCATACAAGAGAAGTATGAGCATGGTGCTGGAGGA
AGTCTTTTCAGAATAGCAAATGATATCCTCCTCCTAGACGATATTGCTGCAGAAGAAXACATTGCAGCTCCAAAGGCTGATTCATCTGCT
ATTCGAGAATCTTCTTCTTTCTTGGACTCTGTATTGGCTATTAACCAGACAGGAAAGTTGCAGGAATCTCCTGCACAAACTCTTGATGAT
CTTATACCATCCCTCCGGAAATTACGCAAGCTAGCAGATCTCTTGGATATGCCATTGAAATCTATTACTGCAGCTTGGGAAACTGATGAA
CTTGCCAACCATGGTTTTAAGCAATCAGAGGTTGAAGACTTCATCCGAGCCATATTTGCAGATTCACCTCTGAGGAAAGATGCTTACGAA
GAATAG\
Edits in Original Sequence 
(5')XXGTCTGAAGCAGCGTCACGACTAATGAAGTTAGTTCATGGAACACTCAAGGATGTTTGCCTGTCATCTTCTAGAGTGGGGTTGGA
ATTCTATCACGCTGCTCGGGATTCTCTACTTCTTTATGAAGCTATCATACATGTTAAGTTCGAAAGGCAGCTTGATTCCATCAACCATTC
TGCCGTTCTTATTCACAATGATTGCCACTATCTCTCTCAGGAGATTCTTGGACTTGCATTTGAGTACCGCTCAGACTTTCCAGCTTCAAT
GAAGGAACTTGTTGTATTTGCGAATTTGGCTTCAAGATTCCAGATGCTTGCAGAAGAAGTTTTTCAAAGACAAATTAAACTTGTCATTTA
CAACCTAAAACAGGCTATTGATGAAGCCGATGGATTTCAAAATACTCATCAAATGAAGCAATATGAATCTGCTAAGTTGAGCATTGACCC
AGGTGATTTTCAtACTTGAGAAAGTATATATTXATATGGCACCGTTTACTCCTACCTTCTGCATACAAGAGAAGTATGAGCATGGTGCTG
GAGGAAGTCTTTTCtAGAATAGCAAATGATATCCTCCTCCTAGACGATATTGCTGCAGAAGAAXACATTGCAGCTCCAAAGGCTGATTCA
TCTGCTATTCGAGAATCTgTCTTCTTTCTTGGACTCTGTATTGGCTATTAACCAGACAGGAAAGTTGCAGGAATCTCCTGCACAAACTCT
TGATGATCTTATACCATCCCTCCGGAAATTACGCAAGCTAGCAGATCTCTTGGATATGCCATTGAAATCTATTACTGCAGCTTGGGAAAC
TGATGAACTTGCCAACCATGGTTTTAAGCAATCAGAGGTTGAAGACTTCATCCGAGCCATATTTGCAGATTCACCTCTGAGGAAAGAgTG
CTTACGAAGAATAG\(3')AAAGTAGATATTACCAAGCTTTCAGTTACAGTTAGCTCATTGGTTGCTACAGCTAGAAGTTTTACTTGTGT
TGGATCTCTCTCAACCTCGATAAGTTGCTTGCGATCATTTTTTTCTTTGTTGCTTCAGGAGACTTTTATAGTCCATTTATTCTATAAGTT
TTAAAATCAATGAATTGCTATCTTTATGTATTTAGTGGAGTTTGGCAGTTCGAACTTCGAACCATAGAATCTACTTGATAGGCTTCTTCA
TGTGAAATGTAAATCTGTTCATTGTACATTTATGAGAATAGCATACTGCTGACAGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan