ESTScan Details for Unigene SGN-U273276

Score 
480
Direction 
Forward
Predicted Peptide Sequence 
FPDRSGNWREQKTHKEVVPLLSCRCTITITSIESIKKRVLRAAMGGNLELNHEEHREEDRNATVDSRFNQTLRNVQGLLKGRSFPGKVLI
TRRSDPLDNSTIRSPDNHGSLRDSETGPSQQADGSFEDELQSRSNLNASSSASQTKSSTSNSEHTSNEVQKPSIGSRATDSARLMKFTKE
LSATTVILEKLRELSWNGIPSYLRPNIWRLLLGYAPPNSDRREGVLRRKRLDYLDCVAQYYDIPDIERTDEEINMLRQIAVDCPRTVPDX
FFFPTSTSSEIPGAHTLPRAKKVQAIVQHTCKGLSFSSLLFAGSIXLLILEIPFHLVTRLWDTYLAVGDALPDFLVYIAASFLLTKAAEA
RLPRDGYVPSTPSNS
Predicted Coding Sequence 
XATTTTCCTGACCGAAGTGGAAACTGGAGAGAGCAAAAGACGCATAAAGAAGTTGTACCTTTGTTGAGTTGCAGGTGTACCATAACCATC
ACTTCCATTGAAAGCATTAAGAAAAGAGTTTTGAGAGCAGCAATGGGTGGTAACCTAGAGTTAAACCATGAGGAGCACAGAGAGGAAGAT
CGAAATGCTACTGTTGATTCAAGATTCAATCAAACTCTCAGAAATGTTCAAGGGTTGTTAAAGGGACGCAGTTTCCCTGGCAAAGTACTG
ATTACACGGAGGTCAGACCCACTGGATAACTCAACTATAAGATCTCCAGATAATCATGGAAGTCTAAGAGATAGTGAGACGGGACCAAGC
CAACAGGCAGATGGATCTTTTGAGGATGAACTGCAAAGTAGAAGCAATCTGAATGCTAGCTCATCTGCTAGCCAGACAAAATCATCAACG
TCAAATTCAGAACACACATCCAACGAAGTACAGAAGCCATCAATTGGCTCTAGAGCTACTGATTCGGCTAGGCTAATGAAGTTCACAAAA
GAATTGTCTGCGACAACTGTCATTCTAGAAAAATTGCGTGAATTATCTTGGAATGGCATCCCATCATATCTGCGGCCCAACATATGGCGG
CTTCTTTTGGGATATGCACCCCCTAATTCAGATAGAAGGGAGGGAGTTCTGAGAAGAAAGCGTCTAGATTATCTTGATTGTGTTGCTCAG
TACTATGATATTCCAGATATCGAGCGAACAGATGAAGAGATCAACATGCTTCGCCAGATTGCTGTTGATTGCCCTAGAACAGTGCCTGAT
GXTTTCTTTTTTCCAACAAGCACAAGTTCAGAAATCCCTGGAGCGCATACTTTACCTAGAGCTAAGAAAGTACAAGCAATCGTCCAACAC
ACATGCAAGGGCTTGAGTTTCTCCAGTTTGCTTTTCGCTGGTTCAATTGXTCTCTTGATACTCGAGATCCCTTTCCATCTTGTTACCCGA
TTATGGGATACATATCTTGCAGTAGGTGATGCACTGCCAGATTTTCTTGTGTATATAGCTGCAAGCTTTCTTCTCACAAAAGCTGCTGAA
GCTCGACTTCCAAGAGATGGTTATGTTCCTTCAACACCTTCCAACTCATAA\
Edits in Original Sequence 
(5')XATTTTCCTGACCGAAGTGGAAACTGGAGAGAGCAAAAGACGCATAAAGAAGTTGTACCTTTGTTGAGTTGCAGGTGTACCATAAC
CATCACTTCCATTGAAAGCATTAAGAAAAGAGTTTTGAGAGCAGCAATGGtGTGGTAACCTAGAGTTAAACCATGAGGAGCgACAGAGAG
GAAGATCGAAATGCTACTGTTGATTCAAGATTCAATCAAACTCTCAGAAATGTTCAAGGGTTGTTAAAGGGACGCAGTTTCCCTGGCAAA
GTACTGATTACACGGAGGTCAGACCCACTGGATAACTCAACTATAAGATCTCCAGATAATCATGGAAGTCTAAGAGATAGTGAGACGGGA
CCAAGCCAACAGGCAGATGGATCTTTTGAGGATGAACTGCAAAGTAGAAGCAATCTGAATGCTAGCTCATCTGCTAGCCAGACAAAATCA
TCAACGTCAAATTCAGAACACACATCCAACGAAGTACAGAAGCCATCAATTGGCTCTAGAGCTACTGATTCGGCTAGGCTAATGAAGTTC
ACAAAAGAATTGTCTGCGACAACTGTCATTCTAGAAAAATTGCGTGAATTATCTTGGAATGGCATCCCATCATATCTGCGGCCCAACATA
TGGCGGCTTCTTTTGGGATATGCACCCCCTAATTCAGATAGAAGGGAGGGAGTTCTGAGAAGAAAGCGTCTAGATTATCTTGATTGTGTT
GCTCAGTACTATGATATTCCAGATATCGAGCGAACAGATGAAGAGATCAACATGCTTCGCCAGATTGCTGTTGATTGCCCTAGAACAGTG
CCTGATGXTTTCTTTTTTCCAACAAGCACAAGTTCAGAAATCCCTGGAGCGCATACTTTACCTAtGAGCTAAGAAAGTACAAGCAATCGT
CCAACACACATGCAAGGGCTTGAGTTTCTCCAGTTTGCTTTTCGCTGGTTCAATTGXTCTCTTGATACTCGAGATCCCTTTCCATCTTGT
TACCCGATTATGGGATACATATCTTGCAGTAGGTGATGCACTGCCAGATTTTCTTGTGTATATAGCTGCAAGCTTTCTTCTCACAAtAAG
CTGCTGAAGCTCGACTTCCAAGAGATGGTTATGTTCCTTCAACACCTTCCAACTCATAA\(3')CTGGAGTCATTCTTCTCATAAATGAT
GTGTTTAATTAGAGAGAGTCCATCAAATGTAAAACAAATTGAAAGCCTTATTGTTAACTTCATATGTGATAGTTGTATACTTCACTCTGC
TCCAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan