ESTScan Details for Unigene SGN-U273330

Score 
453
Direction 
Forward
Predicted Peptide Sequence 
GIYGEWSLFFQPLYSQNPFLSSLSLETLVTATPAHHGDQLPEPRMPNDEAKYPEVDQAVMIQVKSMADSGAYVALLEYNNIEGMILFSEL
SRRRIRSISSLIKVGRIEPVMVLRVDKEKGYIDLSKRRVSEEDISACEERYNKSKLVHSIMRHVAETMGIDLEDLYIHVGWPLYRKYGHA
FEAFKLVVSDPDSILNSLTREVKEIGPDGKEVTKVAPALSEEVKDALVKNIRRRMTPQPLKIRADIXAVKCFQFDGVLHIKEAMXEKAEA
AG
Predicted Coding Sequence 
GGAATATATGGCGAGTGGTCTCTCTTCTTTCAGCCCCTCTACAGTCAAAACCCATTCCTATCATCTCTTTCTCTGGAAACCCTAGTAACT
GCTACTCCTGCCCATCATGGCGACCAACTCCCCGAACCTCGAATGCCGAATGACGAAGCCAAGTACCCTGAAGTAGACCAAGCTGTGATG
ATACAGGTGAAAAGCATGGCTGACAGCGGCGCCTACGTTGCCCTTCTAGAGTACAATAACATAGAAGGAATGATCCTTTTCTCTGAGCTC
TCTCGTCGTCGTATTCGGAGTATTAGCAGTCTTATCAAAGTTGGACGCATCGAACCGGTCATGGTTCTTAGGGTTGATAAGGAGAAAGGA
TATATCGATCTCAGTAAACGAAGGGTTTCTGAGGAAGATATTTCGGCTTGTGAGGAGAGGTATAATAAGAGTAAGCTTGTTCATTCAATC
ATGCGTCATGTTGCTGAAACCATGGGAATTGATCTGGAGGACTTGTATATTCATGTAGGTTGGCCTTTATATAGAAAATATGGTCATGCT
TTTGAGGCATTCAAATTGGTTGTCAGTGATCCAGATTCAATACTTAATTCCCTCACTCGTGAAGTCAAAGAAATTGGTCCTGATGGGAAG
GAGGTAACTAAAGTTGCTCCTGCTTTGTCCGAGGAAGTTAAAGATGCATTGGTAAAGAATATTAGGAGAAGAATGACTCCACAGCCATTG
AAGATTCGAGCAGATATTGXAGCAGTGAAATGTTTTCAGTTTGATGGTGTTCTTCACATTAAGGAAGCTATGCXGGAAAAAGCTGAGGCT
GCTGGT\
Edits in Original Sequence 
(5')GGAATATATGGCGAGTGGTCTCTCTTCTTTCAGCCCCTCTACAGTCAAAACCCATTCCTATCATCTCTTTCTCTGcGAAACCCTAG
TAACTGCTACTCCTGCCCATCATGGCGACCAACTCCCCGAACCTCGAATGCCGAATGtACGAAGCCAAGTACCCTGAAGTAGACCAAGCT
GTGATGATACAGGTGAAAAGCATGGCTGACAGCGGCGCCTACGTTGCCCTTCTAGAGTACAATAACATAGAAGGAATGATCCTTTTCTCT
GAGCTCTCTCGTCGTCGTATTCGGAGTATTAGCAGTCTTATCAAAGTTGGACGCATCGAACCGGTCATGGTTCTTAGGGTTGATAAGGAG
AAAGGATATATCGATCTCAGTAAACGAAGGGTTTCTGAGGAAGATATTTCGGCTTGTGAGGAGAGGTATAATAAGAGTAAGCTTGTTCAT
TCAATCATGCGTCATGTTGCTGAAACCATGGGAATTGATCTGGAGGACTTGTATATTCATGTAGGTTGGCCTTTATATAGAAAATATGGT
CATGCTTTTGAGGCATTCAAATTGGTTGTCAGTGATCCAGATTCAATACTTAATTCCCTCACTCGTGAAGTCAAAGAAATTGGTCCTGAT
GGGAAGGAGGTAACTAAAGTTGCTCCTGCTTTGTCCGAGGAAGTTAAAGATGCATTGGTAAAGAATATTAGGAGAAGAATGACTCCACAG
CCATTGAAGATTCGAGCAGATATTGXAGCAGTGAAATGTTTTCAGTTTGATGGTGTTCTTCACATTAAGGAAGCTATGCXGGAAAAAGCT
GAGGCTGCTGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan