Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U273398

Score 
867
Direction 
Forward
Predicted Peptide Sequence 
LSYPSSMKDPEKSNIAMGVHLFDYTELEEATNNFDSKKELGDGGYGTVYKGKLRDGRVVAVKRLYENNCKRVEQFMNEIDILTRLHHPNL
VTLYGCTSRHSRELLLVYEYIPNGTVADHLHGGDSRRGLPSWNTRMKIAIETANALAYLHASDVIHRDVKTNNILLDNNFCVKVADFGLS
RLFPTHLTHVSTAPQGTPGYVDPEYHECYQLTDKSDVYSFGVVLVELISSLPAVDICRHRHEINLSNMAINKIQSNALHELVDPNIGFDT
DDKIRSMITAMAELAFQCLQNDGDMRPSMQEVVEALLRIQRKNKTGKTDKGHPDDDDAGLSKNNTSLISPNSVLQNGVAAQQHPMAVPSI
WFSKVVHSNAFHVGFQNLNYIHFDYLVFSVKEDXTYVSAARLMIRFELLKSSFIFSIFSSDLLIVAVRVSFSASNGRIGLVSREHYPYSV
V
Predicted Coding Sequence 
CTTTCCTATCCTTCCTCCATGAAGGATCCTGAAAAGTCAAATATAGCTATGGGAGTTCACCTCTTTGACTACACTGAACTGGAAGAAGCC
ACTAACAATTTTGATTCCAAGAAAGAGCTTGGAGATGGTGGATATGGCACAGTATATAAAGGTAAACTTCGAGATGGACGTGTCGTTGCT
GTTAAACGTTTGTATGAAAACAACTGCAAGAGAGTAGAGCAATTCATGAATGAAATTGATATCCTAACACGGTTGCATCATCCGAACCTT
GTCACTCTTTACGGATGCACATCTCGCCATTCCCGTGAGCTTCTACTTGTTTATGAATACATTCCAAATGGCACAGTTGCTGATCATCTA
CACGGTGGAGATTCACGGCGTGGATTGCCTTCATGGAATACACGAATGAAAATTGCCATAGAAACAGCAAACGCACTTGCCTATCTCCAT
GCTTCAGATGTCATCCACCGTGATGTAAAAACTAATAATATCCTTCTAGACAACAATTTCTGTGTTAAAGTAGCAGATTTTGGCTTGTCT
CGGCTTTTCCCAACGCATCTTACTCATGTCTCAACAGCTCCACAGGGCACTCCTGGATATGTTGATCCTGAGTACCACGAGTGCTATCAG
CTCACTGACAAAAGTGATGTTTATAGTTTCGGAGTGGTATTAGTTGAGCTTATATCATCACTGCCTGCTGTTGATATCTGTAGGCATCGA
CATGAAATTAATTTGTCAAATATGGCCATCAACAAGATTCAGAGCAATGCATTACATGAGTTGGTGGATCCGAATATCGGGTTTGACACT
GATGATAAAATAAGGTCAATGATAACTGCAATGGCAGAGTTGGCATTCCAATGTCTACAGAATGATGGGGATATGAGGCCATCTATGCAG
GAAGTTGTGGAGGCTCTGCTGAGAATTCAGAGAAAGAATAAAACTGGGAAAACAGACAAGGGTCATCCTGATGACGATGATGCAGGCTTG
TCGAAGAATAACACATCATTAATTTCACCTAATTCGGTTCTGCAAAATGGAGTAGCAGCTCAACAACACCCAATGGCAGTACCTAGCATT
TGGTTCTCTAAGGTGGTGCACTCAAACGCCTTCCATGTTGGTTTCCAAAACCTGAATTACATACACTTTGATTACTTGGTTTTCTCTGTT
AAAGAGGATGXTACATATGTCAGTGCAGCACGTTTAATGATTCGATTTGAACTTCTCAAGTCTTCTTTTATCTTTTCGATCTTCTCAAGT
GATCTGCTGATTGTAGCAGTACGTGTTTCATTTAGTGCTAGCAATGGAAGAATAGGATTAGTTTCAAGAGAACATTATCCGTATAGTGTA
GTATGA\
Edits in Original Sequence 
(5')CTTTCCTATCCTTCCTCCATGAAGGATCCTGAAAAGTCAAATATAGCTATGGGAGTTCACCTCTTTGACTACACTGAACTGGAAGA
AGCCACTAACAATTTTGATTCCAAGAAAGAGCTTGGAGATGGTGGATATGGCACAGTATATAAAGGTAAACTTCGAGATGGACGTGTCGT
TGCTGTTAAACGTTTGTATGAAAACAACTGCAAGAGAGTAGAGCAATTCATGAATGAAATTGATATCCTAACACGGTTGCATCATCCGAA
CCTTGTCACTCTTTACGGATGCACATCTCGCCATTCCCGTGAGCTTCTACTTGTTTATGAATACATTCCAAATGGCACAGTTGCTGATCA
TCTACACGGTGGAGATTCACGGCGTGGATTGCCTTCATGGAATACACGAATGAAAATTGCCATAGAAACAGCAAACGCACTTGCCTATCT
CCATGCTTCAGATGTCATCCACCGTGATGTAAAAACTAATAATATCCTTCTAGACAACAATTTCTGTGTTAAAGTAGCAGATTTTGGCTT
GTCTCGGCTTTTCCCAACGCATCTTACTCATGTCTCAACAGCTCCACAGGGCACTCCTGGATATGTTGATCCTGAGTACCACGAGTGCTA
TCAGCTCACTGACAAAAGTGATGTTTATAGTTTCGGAGTGGTATTAGTTGAGCTTATATCATCACTGCCTGCTGTTGATATCTGTAGGCA
TCGACATGAAATTAATTTGTCAAATATGGCCATCAACAAGATTCAGAGCAATGCATTACATGAGTTGGTGGATCCGAATATCGGGTTTGA
CACTGATGATAAAATAAGGTCAATGATAACTGCAATGGCAGAGTTGGCATTCCAATGTCTACAGAATGATGGGGATATGAGGCCATCTAT
GCAGGAAGTTGTGGAGGCTCTGCTGAGAATTCAGAGAAAGAATAAAACTGGGAAAACAGACAAGGGTCATCCTGATGACGATGATGCAGG
CTTGTCGAAGAATAACACATCATTAATTTCACCTAATTCGGTTaCTGCAAAATGGAGTAGCAGCTCAACAACACCCAATGGCAGTACCTA
GCATTTGGTTCTCTAAGGTGGTGCACTCAAACGCCTTCCATGTTGGTTTCCAAAACCTGAATTACATACACTTTGATTAgCTTGGTTTTC
TCTGTTAAAGAGGATGXTACATATGTCAGTGCAGCACGTTTAATGATTCGATTTGAACTTCTCAAGTCTTCTTTTATCTTTTCGATCTTC
TCAAGTGATCTGCTGATTGTAGCAGTACGTGTTTCATTTAGTGCgTAGCAATGGAAGAATAGGATTAGTTTCAAGAGAACATTATCCGTA
TAGTGTAGTATGA\(3')CAACTGACTGATTTCGAATGTAACATAGAAGTTCAGTGCTCTTAAGCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan