ESTScan Details for Unigene SGN-U273428

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
MGASQSVELPSDEEDEQDEEEDAEHENDTPDERHRLVGDDSLLKKVLEQEPEMLPCHASASPLSPQLSSFGTPRLGPSIKVWDPYNVLAP
PPSIPHFHRTFSSDSVDDDRTLTDLYLISNGECHMNLRPDLIAGRSPEAALTPNGKRQARALAVFLKSQGIRFNSVYTSPLDRARATALS
VCQEINFSEERIQSSDAXTGNESGALGGMPPPDIFTPETTSLMEKFQPDFSAPSGESLRQVEFRMVQFLNGTVMTLPCKFRSDFSPPDQS
ENQGFSNRGSHPLVNSVHDXRWAALFLIIPLGFAPQDRQGLSRKKSGKSRLQIVTTTGDHEADDEMSPREPINPNSIRDLNVQISTNVSQ
CIGIFTAFNPNKVSSYWPSWLQFNDVKKICIDDSSVTVLQHSWKMGWQIKRMNDTAHLRLF
Predicted Coding Sequence 
ATGGGCGCTTCTCAGTCCGTAGAACTACCCTCTGATGAAGAAGACGAACAGGATGAAGAAGAAGATGCGGAGCACGAAAACGATACCCCA
GATGAGAGACACCGATTAGTTGGTGACGACTCTCTGCTCAAAAAGGTTCTCGAACAAGAGCCTGAGATGTTACCTTGCCACGCCTCCGCA
TCCCCTTTATCCCCTCAACTATCCTCTTTCGGCACCCCGCGTTTGGGACCTTCTATCAAGGTCTGGGACCCTTATAATGTTCTCGCTCCA
CCACCCTCAATTCCTCATTTCCACCGAACATTCTCCTCTGATTCTGTCGATGACGATAGGACCCTCACTGACCTATATTTAATTAGTAAT
GGCGAATGTCATATGAATTTAAGACCTGATTTGATTGCCGGCCGATCCCCAGAGGCTGCACTTACACCTAATGGCAAGCGCCAAGCAAGA
GCTTTGGCTGTTTTTCTAAAGTCTCAAGGGATTCGTTTCAATTCTGTCTATACATCTCCCTTGGATCGAGCACGAGCTACTGCCCTCTCT
GTTTGTCAGGAAATAAACTTTTCAGAGGAACGGATACAATCCTCTGATGCTXCTACTGGAAATGAGTCAGGGGCATTGGGAGGGATGCCA
CCGCCGGATATTTTTACACCTGAAACAACTAGCCTAATGGAAAAGTTCCAGCCTGATTTTTCAGCACCATCTGGAGAGTCACTGAGGCAG
GTGGAATTTCGGATGGTACAATTCCTAAATGGAACTGTTATGACATTGCCTTGCAAATTCAGATCTGATTTCTCTCCACCTGATCAGAGT
GAGAACCAGGGCTTCTCAAACCGTGGTTCTCATCCACTTGTCAATTCAGTTCATGACCXGAGATGGGCCGCCCTCTTTCTCATCATCCCA
TTGGGATTTGCACCACAGGATCGACAAGGACTTTCGAGGAAGAAGTCTGGAAAGAGTAGGCTTCAGATCGTGACAACTACTGGGGATCAT
GAGGCTGATGACGAGATGTCACCACGAGAACCCATTAATCCTAACTCCATCCGAGATTTAAATGTGCAAATCAGTACTAATGTTTCTCAA
TGCATTGGTATTTTCACXGCATTCAATCCCAATAAAGTGTCTTCTTACTGGCCTTCTTGGCTGCAGTTCAATGATGTCAAGAAGATATGC
ATAGATGATTCTTCAGTGACAGTGCTACAACATTCCTGGAAAATGGGATGGCAGATCAAGAGAATGAACGATACTGCACATCTTAGGCTT
TTCTAGTAA\
Edits in Original Sequence 
GAGAATGGGACTCTCTATTCTATTCTTCTTTGTAAAAAAAAAGGTCCTCAGATCTCTCTCTCTCTTCCTGTTCCTGAACAACATTACTTC
CTACTTCCCCAAAGCTTGAAGCTTTTTATTTAAACCCCCAATCCGCATACATATTAACCGTAGATCCGAACGATCCAGATTGTACA
(5')
ATGGGCGCTTCTCAGTCCGTAGAACTACCCTCTGATGAAGAAGACGAACAGGATGAAGAAGAAGATGCGGAGCACGAAAACGATACCCCA
GATGAGAGACACCGATTAGTTGGTGACGACTCTCTGCTCAAAAAGGTTCTCGAACAAGAGCCTGAGATGTTACCTTGCCACGCCTCCGCA
TCCCCTTTATCCCCTCAACTATCCTCTTTCGGCACCCCGCGTTTGGGACCTTCTATCAAGGTCTGGGACCCTTATAATGTTCTCGCTCCA
CCACCCTCAATTCCTCATTTCCACCGAACATTCTCCTCTGATTCTGTCGATGACGATAGGACCCTCACTGACCTATATTTAATTAGTAAT
GGCGAATGTCATATGAATTTAAGACCTGATTTGATTGCCGGCCGATCCCCAGAGGCTGCACTTACACCTAATGGCAAGCGCCAAGCAAGA
GCTTTGGCTGTTTTTCTAAAGTCTCAAGGGATTCGTTTCAATTCTGTCTATACATCTCCCTTGGATCGAGCACGAGCTACTGCCCTCTCT
GTTTGTCAGGAAATAAACTTTTCAGAGGAACGGATACAATCCTCTGATGCTXCTACTGGAAATGAGTCAGGGGCATTGGGAGGGATGCCA
CCGCtCGGATATTTTTACACCTGAAACAACTAGCCTAATGGAAAAGTTCCAGCCTGATTTTTCAGCACCATCTGGAGAGTCACTGAGGCA
GGTGGAATTTCGGATGGTACAATTCCTAAATGGAACTGTTATGACATTGCCTTGCAAATTCAGATCTGATTTCTCTCCACCTGATCAGAG
TGAGAACCAGGGCTTCTCAAACCGTGGTTCTCATCCACTTGTCAATTCAGTTCATGACCXGAGATGGGCCGCCCTCTTTCTCATCATCCC
ATTGGGATTTGCACCACAGGaATCGACAAGGACTTTCGAGGAAGAAGTCTGGAAAGAGTAGGCTTCAGATCGTGACAACTACTGGGGATC
ATGAGGCTGATGACGAGATGTCACCACGAGAACCCATTAATCCTAACTCCATCCGAGATTTAAATGTGCAAATCAGTACTAATGTTTCTC
AATGCATTGGTATTTTCACXGCATTCAATCCCAATAAAGTGTCTTCTTACTGGCCTTCTTGGCTGCAGTTCAATGATGTCAAGtAAGATA
TGCATAGATGATTCTTCAGTGACAGTGCTACAACATTCCTGGAAAATGGGATGGCAGATCAAGAGAATGAACGATACTGCACATCTTAGG
CTTTTCTAGTAA\(3')ATTATTCCATTCAATAGCTGAGATCACTGAGAAATTTTCAAGAATTCACGGGATGTGTATTCTACAATTAGAT
TCAGATCTCGGGGGGTTATACATTCTCAATTTCTTTTCCTACTTGTACAATTGCATGCTGATACTGAATTGGAGAACCACGGCTGTGGAT
TATTATTTCAGTTTGTAGAATTTTAAATTTTTGATATTGTAGGGCAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan