ESTScan Details for Unigene SGN-U273451

Score 
243
Direction 
Forward
Predicted Peptide Sequence 
EQELLALEERMGTVSTALPEEAVSKCLQRSIYQGMHSELGEFGGDGDEAEIKCSICQEDYVIGDEIGKLECKHGYHMECVQQWLKHKNWC
PICKTSAAASSKLTTAPS
Predicted Coding Sequence 
GAACAGGAATTACTAGCTCTTGAAGAGAGGATGGGCACTGTCAGCACAGCTCTGCCGGAGGAGGCAGTATCAAAGTGTCTTCAAAGAAGC
ATTTATCAAGGCATGCACTCGGAACTAGGGGAATTTGGAGGTGATGGGGATGAAGCTGAGATCAAATGCAGTATTTGTCAGGAGGATTAT
GTGATTGGAGATGAAATCGGAAAGTTGGAATGCAAGCATGGTTATCACATGGAATGTGTACAACAATGGTTAAAGCACAAGAATTGGTGC
CCAATCTGCAAGACATCAGCAGCAGCTTCATCAAAGCTAACAACAGCACCATCTTAG\
Edits in Original Sequence 
GAGAGTTAACATATGAGGTATATTTTAGTACTTCTGACCACCTGACAATGTCCTATCTGGATTTATCAATGGAACTATTGTTTTCTGTCT
ACAGCAGCTGCTTGCATTGGAGACGAACTTGCTGCTTAGCGGCCTTAACTTCTATGACCAGCATAGGGACATGAGACTGGATATAGATAG
CATGTCCTATGAGGTCTCTTTTGCAGTTCTGATACTTTATGAGTACTGAGTATTTAAAAAAGTATTCATTCTTATATCAACAATCTAAGA
AAGTCATTTTCTAGCTGAAATCTTCTCAAGTTAGAGTACTATTCCTTGGGGGGTAAAAGAATAGTTTTTCTCCCGGTATAGTATGATTCT
ATAGCTTCCAGGTCATGATTTATTGCTTGT
(5')GAACAGGAATTACTAGCTCTTGAAGAGAGGATGGGCACTGTCAGCACAGCTCTGCC
GGAGGAGGCAGTATCAAAGTGTCTTCAAAGAAGCATTTATCAAGGCATGCACTCGGAACTAGGGGAATTTGGAGGTGATGGGGATGAAGC
TGAGATCAAATGCAGTATTTGTCAGGAGGATTATGTGATTGGAGATGAAATCGGAAAGTTGGAATGCAAGCATGGTTATCACATGGAATG
TGTACAACAATGGTTAAAGCACAAGAATTGGTGCCCAATCTGCAAGACATCAGCAGCAGCTTCATCAAAGCTAACAACAGCACCATCTTA
G\(3')TTTAGATCAATTCAAACACCAAATCCGACGAAAAAATAATATAAAAATAAATTTAGACACCAAAATTCCAGATGTGGGGAAGCT
GAATTGTTTCCTTACTGTACAAGTTCATCCAGATGGTTGGTTCTAGCATTTTATTTTTCTCCTTTTTCCTTGATTCTTGTACATTTTGTG
TTTCACTTGTAAATATTTGACATTTTAAGCTGTAAGCTCAGGTTTTTATTAAGAATGAATTACAAGGATATAAGTAAGCTACTAACTAAA
GCCATGACATGCTATGGAACCTCCACCGTGCTGAGGGAGGGGGACCAAGCAGGGCGCGTCTTTGTACCTCACTGAAGTAATCCAATATGG
AGTGAAAGGTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan