ESTScan Details for Unigene SGN-U273454

Score 
837
Direction 
Forward
Predicted Peptide Sequence 
MASKINVMALVMVLIVAINWNGALAQSSCMTTLVGLSPCLNYVSGNSSTPSSLVAHHYLVLSNPIPNAFXVLVNGGGSNLGIAINQTLAL
GLPSACNLQTPPASRCNAANGPTGSAEVPASSPAGSTTPSDSSNEIPATPGATGSKTVPSTPGSSSSSAGSNSKFSISTFVGFLLFVALT
TRGF
Predicted Coding Sequence 
ATGGCATCCAAAATCAATGTGATGGCTCTAGTCATGGTTCTAATTGTGGCCATTAATTGGAATGGAGCTTTAGCTCAATCAAGTTGTATG
ACTACACTTGTAGGATTATCACCTTGTTTGAATTATGTTAGTGGAAATTCATCAACACCATCTTCTCTTGTTGCACATCACTATCTAGTG
TTGTCCAATCCAATCCCCAATGCCTTTGXTGTGTTGGTTAATGGTGGTGGTTCTAATCTTGGTATTGCTATTAATCAAACTCTTGCTCTA
GGATTACCTAGTGCATGCAATTTACAAACTCCTCCTGCCAGCCGCTGCAATGCTGCAAATGGACCAACAGGTTCAGCTGAAGTACCAGCA
AGTTCTCCTGCAGGTTCAACTACCCCATCTGATTCCTCTAATGAAATCCCAGCAACTCCAGGTGCTACAGGTTCAAAAACAGTTCCTTCA
ACACCTGGATCATCATCATCATCTGCTGGAAGCAACTCAAAATTTTCTATCAGTACTTTTGTTGGGTTCCTACTGTTTGTTGCTTTGACC
ACCAGGGGATTCTGA\
Edits in Original Sequence 
ACAAAACATACAATCAACCAATAATTTTCTTTTTCTTTTAGCCTCAAATTAAGAAAA(5')ATGGCATCCAAAATCAATGTGATGGCTCT
AGTCATGGTTCTAATTGTGGCCATTAATTGGAATGGAGCTTTAGCTCAATCAAGTTGTATGACTACACTTGTAGGATTATCACCTTGTTT
GAATTATGTTAGTGGAAATTCATCAACACCATCTTCaTCTTGTTGCACATCACTATCTAGTGTTGTCCAATCCAATCCCCAATGCCTTTG
XTGTGTTGGTTAATGGTGGTGGTTCTAATCTTGGTATTGCTATTAATCAAACTCTTGCTCTAGGATTACCTAGTGCATGCAATTTACAAA
CTCCTCCTGCCAGCCGCTGCAATGCTGCAAATGGACCAACAGGTTCAGCTGAAGTACCAGCAAGTTCTCCTGCAGGTTCAACTACCCCAT
CTGATTCCTCTAATGAAATCCCAGCAACTCCAGGTGCTACAGGTTCAAAAACAGTTCCTTCAACACCTGGATCATCATCATCATCTGCTG
GAAGCAACTCAAAATTTTCTATCAGTACTTTTGTTGGGTTCCTACTGTTTGTTGCTTTGACCACCAGGGGATTCTGA\(3')AGTTTTTT
GGAGAAAAAAAGTCATTTTTATGTCAATGTTGTATTAAAATTACTGTTGTTATTATTCTTTTGGTTCCTCTGTTTTAGTAGGAGTGTCAT
ACTGGTTGTAATTTACCTATATTATTTATTGTGACTTATTTAATTTTGAGTAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan