ESTScan Details for Unigene SGN-U273472

Score 
783
Direction 
Forward
Predicted Peptide Sequence 
VSQGKGRRVVHYYLKDTSGELILAVVGTERSTRHILYVVSEDYLDAFGHTSTVNSDXKVAYKKRGRGMADVFDFKASPITTYFRYPKKRK
EKKCFNGWAHSDEVSKNITREDPSAQGSSGSRSVDESSHSGIRRSIPGKQIAKSRPPTYPKLKIKFPSSRPAGIQLVELQNKLSFEVDDN
LEVLCNDSGMRSCWFKCKVLQVSQKRLKVQYDDIRDCDGPEKLEEWIPSYRVAVSDKLGMRCTGRLTVRPRPLVDSSDYSFEVGAAVDAW
WSDGWWEGVVAGFDVCGSAQLQVYFPGENILLETQRKNVRTSRDWVDDKWVEVEGKKDIKSFISSSSTYISTCSIKEPGNCENQMSPKLV
ASEDNKMASTSKHSAEKQDTDVLKLKGDGVLIFLQVTRTDFRQFYKDNAGV
Predicted Coding Sequence 
GTTTCTCAGGGGAAGGGCCGTCGTGTTGTGCACTACTACTTGAAGGATACCTCAGGGGAGTTAATCCTTGCTGTGGTGGGTACTGAAAGA
AGTACAAGGCACATACTATATGTTGTCTCAGAGGATTATTTGGATGCTTTTGGGCATACTAGTACCGTAAATTCTGACAXCAAAGTGGCG
TACAAGAAAAGAGGTAGAGGAATGGCTGACGTTTTTGATTTCAAAGCATCACCAATCACCACCTATTTCAGATACCCCAAGAAGCGAAAA
GAGAAGAAGTGCTTTAATGGCTGGGCACATTCTGATGAGGTCTCAAAAAATATAACCCGAGAAGATCCTTCAGCGCAAGGATCTAGTGGG
AGTAGAAGTGTCGATGAGAGTAGCCATTCTGGTATCAGAAGGTCAATTCCTGGTAAGCAGATAGCAAAATCCAGACCACCAACTTACCCG
AAGTTGAAAATAAAATTTCCAAGCTCAAGACCGGCTGGAATTCAGCTTGTTGAGCTTCAAAATAAGTTGTCTTTTGAAGTTGATGACAAC
TTAGAGGTTCTTTGCAACGATAGTGGCATGAGAAGCTGCTGGTTCAAGTGTAAGGTCTTACAGGTATCTCAAAAACGTCTAAAAGTTCAA
TATGATGACATCCGGGATTGTGATGGTCCTGAAAAGCTCGAGGAATGGATTCCTTCCTACAGAGTCGCAGTCTCTGATAAATTGGGCATG
AGATGCACAGGACGCCTCACAGTTCGTCCCCGACCTCTGGTGGATTCTTCTGACTATTCTTTTGAAGTAGGAGCTGCAGTTGATGCTTGG
TGGTCTGACGGATGGTGGGAAGGTGTTGTTGCTGGATTTGATGTCTGTGGAAGCGCTCAGCTTCAGGTTTACTTCCCTGGCGAGAACATA
TTACTGGAGACTCAAAGGAAGAATGTGAGGACTTCAAGAGATTGGGTTGATGACAAATGGGTTGAAGTTGAGGGAAAGAAAGACATAAAG
TCGTTCATAAGCTCGAGTTCAACTTATATATCCACGTGCAGTATCAAAGAGCCAGGGAACTGCGAAAATCAGATGTCTCCCAAGCTTGTG
GCATCTGAAGACAACAAAATGGCGTCAACTTCTAAACACTCAGCGGAGAAGCAAGACACTGATGTGCTTAAACTGAAAGGCGATGGTGTA
TTGATTTTCTTGCAGGTAACAAGAACTGATTTCAGACAATTCTACAAGGATAATGCTGGCGTCTAG\
Edits in Original Sequence 
(5')GTTTCTCAGGGGAAGGGCCGTCGTGTTGTGCACTACTACTTGAAGGATACCTCAGGGGAGTTAATCCTTGCTGTGGTGGGTACTGA
AAGAAGTACAAGGCACATACTATATGTTGTCTCAGAGGATTATTTGGATGCTTTTGGGCATACTAGTACCGTAAATTCTGACAXCAAAGT
GGCGTACAAGAAAAGAGGTAGAGGAATGGCTGACGTTTTTGATTTCAAAGCATCACCAATCACCACCTATTTCAGATACCCCAAGAAGCG
AAAAGAGAAGAAGTGCTTTAATGGCTGGGCACATaTCTGATGAGGTCTCAAAAAATATAACCCGAGAAGATCCTTCAGCGCAAGGATCTA
GTGGGAGTAGAAGTGTCGATGAGAGTAGCCATTCTGGTATCAGAAGGTCAATTCCTGGTAAGCAGATAGCAAAATCCAGACCACCAACTT
ACCCGAAGTTGAAAATAAAATTTCCAAGCTCAAGACCGGCTGGAATTCAGCTTGTTGAGCTTCAAAATAAGTTGTCTTTTGAAGTTGATG
ACAACTTAGAGGTTCTTTGCAACGATAGTGGCATGAGAAGCTGCTGGTTCAAGTGTAAGGTCTTACAGGTATCTCAAAAACGTCTAAAAG
TTCAATATGATGACATCCGGGATTGTGATGGTCCTGAAAAGCTCGAGGAATGGATTCCTTCCTACAGAGTCGCAGTCTCTGATAAATTGG
GCATGAGATGCACAGGACGCCTCACAGTTCGTCCCCGACCTCTGGTGGATTCTTCTGACTATTCTTTTGAAGTAGGAGCTGCAGTTGATG
CTTGGTGGTCTGACGGATGGTGGGAAGGTGTTGTTGCTGGATTTGATGTCTGTGGAAGCGCTCAGCTTCAGGTTTACTTCCCTGGCGAGA
ACATATTACTGGAGACTCAAAGGAAGAATGTGAGGACTTCAAGAGATTGGGTTGATGACAAATGGGTTGAAGTTGAGGGAAAGAAAGACA
TAAAGTCGTTCATAAGCTCGAGTTCAACTTATATATCCACGTGCAGTATCAAAGAGCCAGGGAACTGCGAAAATCAGATGTCTCCCAAGC
TTGTGGCATCTGAAGACAACAAAATGGCGTCAACTTCTAAACACTCAGCGGAGAAGCAAGACACTGATGTGCTTAAACTGaAAAGGCGAT
GGTGTATTGATTTTCTTGCAGGTAACAAGAACTGATTTCAGACAATTCTACAAGtGATAATGCTGGCGTCTAG\(3')CAGTCGTCAGTT
CTTTTCGATAACAGTGAAATGTTTTTGGCACTGTGGGTAATTCTCAACGGTGCTCGATTTGCCTTTGTAAATGTATAGGCCTTTGACAAC
AAAACATGGAAAAGGCATCTCATAGAGCTTTAGATAAGCAGTCTTTTTTCTTACCTCTCCCTAGTTGCTCGCACCTTTTCGCTTCCTTGA
TAACTCGAACTCACAACCTCAAGGTTGGAAGTAGCTAGATGAGGGTGTTTATCATCCGAGCACACTCTTCTGGTTAGTATATGTATGTGT
TTTACAAATTCACCAAGAAGTTGGTATGCTCTTGTATTGTACACTCTCGTATCGATTATACATATCAATATAGAAGTTGAATAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan