ESTScan Details for Unigene SGN-U273508

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
QFHSKAAMEEAEEXEPEELPEMGSGAGESQILLQLVQPNQIHVWETPFVSXNFPKAGGRGLAAVRDIKKGELILRVPKGALMTSQNLMMN
DEAFSIAVKNHPSLCSTQILAVGLLNEANKGKSSRWWPYQNSFPEAXDTLADXGKFEIQALQIDDAIWAAQKASRRAEEEWNEVTQLMHE
LKLKPQFLALKAWLWASGSEVWSELKXLIWNSAMSFLTLVV
Predicted Coding Sequence 
XCCCAGTTCCACAGCAAAGCCGCCATGGAAGAAGCTGAAGAAXTTGAACCTGAAGAGCTTCCTGAAATGGGCAGTGGAGCTGGXGAATCT
CAGATTCTCCTTCAACTTGTACAACCCAATCAGATTCATGTTTGGGAAACACCCTTTGTGTCTXCTAATTTCCCTAAAGCCGGAGGGAGA
GGTTTAGCAGCAGTTCGTGATATTAAGAAAGGGGAATTGATTCTTAGAGTTCCAAAGGGAGCGTTAATGACTAGTCAAAATCTTATGATG
AACGATGAGGCATTCTCCATTGCTGTCAAGAATCACCCTTCTCTGTGCTCCACACAGATATTGGCTGTTGGATTGTTAAATGAAGCGAAC
AAGGGTAAGAGTTCAAGGTGGTGGCCCTATCAAAACAGTTTCCCCGAAGCTXATGACACACTTGCTGATTNTGGCAAATTCGAGATACAA
GCATTGCAAATTGATGATGCCATATGGGCTGCACAAAAGGCTTCTCGGAGGGCTGAAGAGGAGTGGAATGAAGTGACTCAGCTTATGCAT
GAACTGAAGCTCAAGCCACAATTCCTCGCTCTTAAGGCATGGCTCTGGGCCTCTGGTTCTGAAGTATGGAGTGAACTCAAGXTGCTAATC
TGGAATAGTGCTATGTCATTTCTTACTCTAGTGGTCTGA\
Edits in Original Sequence 
(5')XCCCAGTTCCACAGCAAAGCCGCCATGGAAGAAGCTGAAGAAXTTGAACCTGAAGAGCTTCCTGAAATGGGCAGTGGAGCTGGXGA
ATCTCAGATTCTCCTTCAACTTGTACAACCCAATCAGATTCATGTTTGGGAAACACCCTTTGTGTCTXCTAATTTCCCTAAAGCCGGAGG
GAGAGGTTTAGCAGCAGTTCGTGATATTAAGAAAGGGGAATTGATTCTTAGAGTTCCAAAGGGAGCGTTAATGACTAGTCAAAATCTTAT
GATGAACGATGAGGCATTCTCCATTGCTGTCAAGAATCACCCTTCTCTGTGCTCCACACAGATATTGGCTGTTGGATTGTTAAATGAAGC
GAACAAGGGTAAGAGTTCAAGGTGGTGGCCCTATCtAAAACAGTTTCCCCGAAGCTXATGACACACTTGCTGATTNTGGCAAATTCGAGA
TACAAGCATTGCAAATTGATGATGCCATATGGGCTGCACAAAAGGCTTCTCGGAGGGCTGAAGAGGAGTGGAATGAAGTGACTCAGCTTA
TGCATGAACTGAAGCTCAAGCCACAATTCCTCGCTCTTAAGGCATGGCTCTGGGCCTCTGGTTCTGtAAGTATGGAGTGAACTCAAGXTG
CTAATCTGGAATAGTGCTATGTCATTTCTTACTCTAGTGGTCTGA\(3')TTAGAAATCCCTAATTATTGCAAGATTCAAATGCTGTGTT
TGATTCGTGATCTATCTATCACTCTGTCTGTCTTCATTCACAATGTACTTGAGCACCACTGTCTATCAATTAAACAATTTCTTGTCATAT
TCATGGGTTAACATGAAAAAAGTTTCTTACTGAAGATCTCCTCGCGCACCATGCATATACCTTGGGATGAAGCTGGATGTTTATGCCCTG
TGGGGAGATTCTTCCATTATGCAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan