ESTScan Details for Unigene SGN-U273617

Score 
855
Direction 
Forward
Predicted Peptide Sequence 
MAAYSVPPVEELLSKRVQEMVLHGEEPLGPYICRSGDDVDEKEDIMDTSPIPIIDLNLLSSSTTSDNEREQELEKLGSALSSWGCFQGIA
HGISASLLDKIRQVSREFFNQPMEEKNREVLEDYSEKMKMVTEITSKAMAKSLKLEENCFLEQFGKQAQLHARFNYYSPCQRPDLVLGLK
PHADGTGYTIILQDEVGLQVLKDGKWYAVPKNPTALLVLMGDQMEIMSNGIFKSPVHRVVSNSRRDRISIAMFYTPELGKEIGPEDELVN
MDRPRIYKKVTDYAETHWKFYQRGMRALHTAPFRTTIYICPPHVVWAWIESXTTTILALHFFHLMLGLAKKKPPF
Predicted Coding Sequence 
ATGGCTGCATATTCAGTTCCACCTGTAGAGGAGTTGCTGTCAAAAAGAGTTCAAGAAATGGTCCTTCATGGGGAGGAGCCACTAGGACCT
TATATTTGCAGAAGTGGTGACGATGTTGATGAAAAAGAAGACATCATGGATACTTCTCCAATTCCTATAATTGATCTAAACCTCCTGTCT
TCTTCAACAACATCAGATAACGAACGCGAACAAGAGTTGGAGAAACTTGGATCAGCTCTATCTTCTTGGGGATGTTTTCAGGGAATAGCA
CATGGGATTTCAGCTTCTTTACTGGACAAAATCCGCCAAGTTTCAAGGGAATTCTTCAACCAGCCAATGGAAGAGAAGAACAGAGAGGTC
TTAGAAGATTATTCTGAGAAAATGAAAATGGTCACAGAAATTACCTCTAAAGCTATGGCAAAGTCGTTGAAGCTGGAAGAAAATTGCTTC
TTGGAACAATTTGGAAAACAAGCACAACTGCATGCGCGGTTTAACTACTACTCGCCATGTCAGAGGCCTGATCTGGTTCTTGGCTTAAAA
CCCCATGCTGATGGAACAGGATACACAATTATTTTGCAAGATGAAGTAGGACTCCAAGTGCTTAAGGATGGCAAATGGTATGCAGTACCA
AAAAATCCTACAGCTCTGCTTGTTCTCATGGGTGATCAAATGGAGATAATGAGCAATGGAATATTCAAGAGCCCGGTGCATAGGGTAGTG
AGTAATTCAAGGAGGGATAGAATTTCTATCGCAATGTTCTACACGCCTGAATTAGGGAAAGAAATCGGACCAGAAGATGAGTTAGTCAAT
ATGGACAGACCAAGGATATACAAGAAAGTGACAGATTATGCAGAAACTCACTGGAAGTTTTACCAGCGTGGTATGAGAGCACTACACACT
GCACCATTTAGAACTACTATCTATATATGTCCTCCTCATGTTGTTTGGGCATGGATAGAAAGTXCTACAACTACAATTTTGGCTTTACAT
TTTTTTCACCTCATGCTTGGACTCGCGAAGAAAAAGCCACCATTCTAA\
Edits in Original Sequence 
AGTGTTACTTGATCATAGCATAAGC(5')ATGGCTGCATATTCAGTTCCACCTGTAGAGGAGTTGCTGTCAAAAAGAGTTCAAGAAATGG
TCCTTCATGGGGAGGAGCCACTAGGACCTTATATTTGCAGAAGTGGTGACGATGTTGATGAAAAAGAAGACATCATGGATACTTCTCCAA
TTCCTATAATTGATCTAAACCTCCTGTCTTCTTCAACAACATCAGATAACGAACGCGAACAAGAGTTGGAGAAACTTGGATCAGCTCTAT
CTTCTTGGGGATGTTTTCAGGGAATAGCACATGGGATTTCAGCTTCTTTACTGGACAAAATCCGCCAAGTTTCAAGGGAATTCTTCAACC
AGCCAATGGAAGAGAAGAACAGAGAGGTCTTAGAAGATTATTCTGAGAAAATGAAAATGGTCACAGAAATTACCTCTAAAGCTATGGCAA
AGTCGTTGAAGCTGGAAGAAAATTGCTTCTTGGAACAATTTGGAAAACAAGCACAACTGCATGCGCGGTTTAACTACTACTCGCCATGTC
AGAGGCCTGATCTGGTTCTTGGCTTAAAACCCCATGCTGATGGAACAGGATACACAATTATTTTGCAAGATGAAGTAGGACTCCAAGTGC
TTAAGGATGGCAAATGGTATGCAGTACCAAAAAATCCTACAGCTCTGCTTGTTCTCATGGGTGATCAAATGGAGATAATGAGCAATGGAA
TATTCAAGAGCCCGGTGCATAGGGTAGTGAGTAATTCAAGGAGGGATAGAATTTCTATCGCAATGTTCTACACGCCTGAATTAGGGAAAG
AAATCGGACCAGAAGATGAGTTAGTCAATATGGACAGACCAAGGATATACAAGAAAGTGACAGATTATGCAGAAACTCACTGGAAGTTTT
ACCAGCGTGGTATGAGAGCACTACACACTGCACaCATTTAGAACTACTATCTATATATGTCCTCCTCATGTTGTTTGGGCATGGATAGAA
AGTXCTACAACTACAATTTTGGCTTTACATTTTTTTCACCTCATGCTTGGACTCGCGAAGAAAAAGCCACCATTCTAA\(3')TAGATGA
ATCATCCAATGATGATTTGGTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan