Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U273685

Score 
491
Direction 
Forward
Predicted Peptide Sequence 
LGRSPFLSRTCSLEAAXKLGRRARKSKHVKXTVAATGVIVXRQPVNLRRQNDVCPNCGGGFVQVLEDITSSSVDNQSQRPRFMESVSNFL
RRQISATSNTSERGRSDGGAERGNLWNPLLIFSGDTPVQMPGDGGVLEFLNEALGFRQENGGDYFVGPGVEEFFEEIVNRNQRGAPPASR
CSIDSLPTVKISKKDVRSDSHCPVCKEKFALGTKATKLPCKHLYHSDCITPWLEQKNSCPVCRKELIPEKSGNDHSSETQGVKAEAAVGE
LVLGRTVLRTKKGGDHGLPSGTLVHLVLVPEVLQLLKPAHKPAINXNNYSEYSNWPFE
Predicted Coding Sequence 
CTGGGTCGGTCGCCATTTTTATCAAGGACTTGTAGTTTAGAAGCTGCAXTAAAGTTGGGCAGAAGAGCTAGGAAGAGTAAGCATGTCAAG
XTGACAGTTGCAGCCACTGGTGTTATAGTTGXTAGACAACCAGTGAATCTCAGGAGACAAAATGATGTTTGCCCCAATTGCGGTGGTGGA
TTTGTTCAAGTGCTTGAAGACATAACGAGTAGTAGTGTAGATAATCAGAGCCAGAGGCCGAGATTTATGGAATCCGTCTCAAACTTTTTA
AGACGACAAATCTCAGCTACAAGTAATACTTCTGAGAGAGGGAGATCTGATGGGGGTGCTGAACGAGGAAATTTATGGAATCCATTGCTG
ATTTTCAGTGGTGATACGCCTGTTCAGATGCCTGGGGATGGTGGAGTTTTGGAGTTTCTTAATGAGGCTCTTGGCTTCCGACAAGAAAAT
GGTGGTGATTATTTTGTTGGTCCAGGAGTGGAGGAATTTTTTGAAGAAATTGTAAATAGAAATCAGCGTGGTGCTCCTCCTGCCTCAAGA
TGTTCAATTGATTCCCTACCAACAGTCAAGATATCGAAAAAAGATGTTAGATCGGATTCTCACTGCCCTGTTTGTAAAGAGAAATTTGCT
CTGGGGACTAAGGCAACAAAATTGCCTTGCAAGCACTTATATCACTCAGATTGTATCACTCCATGGCTAGAACAGAAGAATTCATGTCCT
GTCTGTAGAAAGGAGCTGATACCTGAAAAATCTGGCAATGACCATTCTTCTGAAACTCAAGGAGTGAAAGCAGAAGCAGCAGTAGGCGAG
TTAGTGCTAGGGAGAACAGTTCTCAGAACCAAGAAAGGCGGAGACCATGGTCTTCCCTCTGGAACTTTGGTTCATCTCGTTCTAGTTCCC
GAAGTACTCCAGCTGCTGAAACCAGCTCACAAACCAGCCATCAACAXCAATAATTACTCTGAGTACTCCAACTGGCCCTTTGAATAA\
Edits in Original Sequence 
CTCAACTTCATCTTTTTGGTCTCTATCTTCCATTTCCCCTCTCTCTCTCTCTCTATATGTAGCAGCTACATTGTGTGTTTTCCTTAAT(5')
CTGGGTCGGTCGCCATTTTTATCAAGGACTTGTAGTTTAGAAGCTGCAXTAAAGTTGGGCAGAAGAGCTAGGAAGAGTAAGCATGTCA
AGXTGACAGTTGCAGCCACTGGTGTTATAGTTGXTAGACAACCAGTGAATCTCAGGAGACAAAATGATGTTTGCCCCAATTGCGGTGGTG
GATTTGTTCAAGTGCTTGAAGACATAACGAGTAGTAGTGTAGATAATCAGAGCCAGAGGCCGAGATTTATGGAATCCGTCTCAAACTTTT
TAAGACGACAAATCTCAGCTACAAGTAATACTTCTGAGAGAGGGAGATCTGATGGGGGTGCTGAACGAGGAAATTTATGGAATCCATTGC
TGATTTTCAGTGGTGATACGCCTGTTCAGATGCCTGGGGATGGTGGAGTTTTGGAGTTTCTTAATGAGGCTCTTGGCTTCCGACAAGAAA
ATGGTGGTGATTATTTTGTTGGTCCAGGAGTGGAGGAATTTTTTGAAGAAATTGTAAATAGAAATCAGCGTGGTGCTCCTCCTGCCTCAA
GATGTTCAATTGATTCCCTACCAACAGTCAAGATATCGAAAAAAGATGTTAGATCGGATTCTCACTGCCCTGTTTGTAAAGAGAAATTTG
CTCTGGGGACTAAGGCAACAAAATTGCCTTGCAAGCACTTATATCACTCAGATTGTATCACTCCATGGCTAGAACAGAAGAATTCATGTC
CTGTCTGTAGAAAGGAGCTGATACCTGAAAAATCTGGCAATGACCATTCTTCTcGAAACTCAAGGAGTGAAAGCAGAAGCAGCAGTAGGC
GAGTTAGTGCTAGGGAGAACAGTTCTCAGAACCAAGAAAGGCGGAGACCATGGTCTTCCCTCTGGAACTTTGGTTCATCTCGTTCTAGTT
CCCGAAGTACTCCAGCTGCTGAAACCAGCTCACAAACCAGCCATCAACAXCAATAATTACTCTGAGTACTCCAACTGGCCCTTTGAATAA
\(3')CAAGGTTTCTCTAAATGTAACCTGTTTTCTTTTTTCAAATTCTTCATGATCATAATGTTCTACCTCTGGTTGAACTTAGACGATT
TCTCATGGTAGAGAACCCCCCCCTCCCCATGTGTTTACTTGCTTGTAATGTACATTTGAAGCTTGTCATGTGTTTCTGATGACTGAATTG
TATTTGGTTTCCAAAGTGCGAAAAAAAAAAAAGGGAAAAAAAACTCGAGGGGGGGCCCGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan