ESTScan Details for Unigene SGN-U273838

Score 
833
Direction 
Forward
Predicted Peptide Sequence 
VSDCPSALKNVVSAPTSSELEGKTTLQDQIPWRGHCSAELVMANDDDFTFCQVGAPDNQDYVDAQKIAQDISEIRIKDEPSNNDGTSQST
GAPWEGKLGNITTSKKQGTVGSLSFTVIDTSPGKQASGTSGQVASKDGGFSVPTYQKQIKPARKPVARAKVPYEKGYSQMDWLKLTRTHP
DLAGLKGQSNRRLISIDEVKEHQNAEAMWTVLKGHVYNITPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEVLMEKCLVGILDEAN
ENFVPLIPETTVSEKHSHYKKIVLNRRRYIFASSEEKLTYHXYIGLTIYILK
Predicted Coding Sequence 
GTGTCCGACTGCCCATCAGCTTTGAAGAACGTTGTGTCGGCTCCAACAAGCAGCGAATTAGAGGGAAAAACAACCCTTCAAGATCAGATT
CCTTGGAGAGGACATTGCTCAGCTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGTGCACCTGATAATCAAGAT
TATGTGGATGCACAGAAGATTGCTCAAGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTACT
GGTGCACCATGGGAAGGTAAATTGGGCAACATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACA
TCTCCAGGCAAGCAAGCAAGTGGAACTTCTGGTCAAGTGGCATCAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGCAAATAAAA
CCTGCTAGGAAGCCTGTAGCTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCT
GACCTTGCAGGATTGAAAGGACAGTCCAACAGGAGACTTATATCAATAGATGAGGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACT
GTTCTTAAAGGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGTGTAGACATGCTGATGAAGGCCGTAGGAAAAGAT
TGCACGGCATTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGAAGCAAAT
GAAAACTTTGTTCCATTGATCCCAGAAACAACTGTATCAGAGAAACATTCTCACTACAAGAAGATTGTTCTTAACAGAAGACGATACATT
TTTGCTTCTTCTGAGGAAAAGCTTACATACCATAGXTATATTGGACTAACTATTTACATACTCAAG\
Edits in Original Sequence 
CCCCCGGGCTGCAGTTTCTCCGGCACGAGGACTGAATGCAAGGAATCAGAAGAAATTCAAGATTGTAACGTAGCGTAG(5')GTaGTCCG
ACTGCCCATCAGCTTTGAAcGAACGTTGTGTCGGCTCCAACAAGCAGCGAATTAGAGGGAAAAACAACCCTTCAAGATCAGATTCCTTGG
AGAGGACATTGCTCAGCTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGTGCACCTGATAATCAAGATTATGTG
GATGCACAGAAGATTGCTCAAGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTACTGGTGCA
CCATGGGAAGGTAAATTGGGCAACATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCCA
GGCAAGCAAGCAAGTGGAACTTCTGGTCAAGTGGCATCAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGCAAATAAAACCTGCT
AGGAAGCCTGTAGCTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCTT
GCAGGATTGAAAGGACAGTCCAACAGGAGACTTATATCAATAGATGAGGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCTT
AAAGGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGTGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCACG
GCATTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGAcAGCAAATGAAAA
CTTTGTTCCATTGATCCCAGAAACAACTGTATCAGAGAAACATTCTCACTACAAGAAGATTGTTCTTAACAGAAGACGATACATTTTTGC
TTCTTCTGAGGAAAAGCTTACATACCATAGXTATATTGGACTAACTATTTACATACTCAAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan