ESTScan Details for Unigene SGN-U273967

Score 
460
Direction 
Forward
Predicted Peptide Sequence 
QENPTPHYHEXKINTPTKLKTQESISSHNPSKKRSNFYPYFPDFATPLPLHEQAFFDFSVQFSSSLVPNSEEVESSPAEAEVXAAFNFAT
NLLKGESSKEFSEGGNLLGTAENMNPNESAKSHAKPDIILTGTAKTCPNGPPLGLVDIGSSENAYLFRVALPGVRHKCNIKFDIQREGRV
RIEGVITESEALKNSLKGYEMKVQQLPSPGPFTISFNLPGPVDPRLCSPQFRTDGILEVIVMKYQIPLVSAEGLPENWYNGSFPAPEFYL
VHIPPYDTWEFYLFNNSCNEYNTASGTRLLNF
Predicted Coding Sequence 
XTTCAAGAAAACCCTACCCCTCATTACCATGAAXCCAAGATAAACACGCCCACAAAGCTCAAAACCCAAGAATCGATCTCATCTCATAAC
CCAAGCAAAAAAAGATCAAATTTTTACCCTTATTTTCCAGATTTTGCTACCCCTTTGCCTCTTCACGAACAAGCCTTTTTTGATTTCTCA
GTTCAGTTTAGTTCTTCCCTCGTGCCGAATTCGGAAGAGGTAGAAAGTTCACCTGCAGAAGCTGAAGTAGXAGCGGCGTTCAATTTTGCT
ACGAATCTCCTCAAAGGAGAGAGCAGTAAAGAATTCAGTGAGGGAGGTAACTTGCTTGGTACAGCTGAAAACATGAATCCAAATGAATCT
GCAAAGTCTCATGCCAAACCTGATATCATTCTGACTGGGACTGCAAAAACATGTCCAAATGGACCGCCACTTGGTTTGGTTGACATAGGC
AGTAGTGAGAATGCATACCTTTTTCGTGTTGCGCTTCCTGGTGTAAGGCATAAATGTAATATCAAATTTGACATACAAAGAGAAGGGAGA
GTCCGGATAGAAGGTGTGATTACAGAGAGTGAGGCTTTGAAAAACTCACTCAAGGGTTATGAGATGAAAGTTCAGCAGCTTCCGTCCCCT
GGGCCTTTTACCATATCGTTCAATTTGCCAGGACCTGTTGATCCCAGATTATGTTCCCCACAGTTTAGAACAGATGGCATTTTGGAAGTC
ATTGTGATGAAATATCAGATACCATTGGTTTCAGCTGAAGGTTTGCCTGAGAATTGGTACAATGGCTCTTTCCCAGCTCCTGAATTCTAT
TTGGTCCACATTCCCCCCTATGACACATGGGAATTCTATTTGTTCAACAACTCTTGTAATGAATATAACACAGCATCAGGAACACGACTT
CTCAACTTCTAG\
Edits in Original Sequence 
(5')XTTCAAGAAAACCCTACCCCTCATTACCATGAAXCCAAGATAAACACGCCCACAAAGCTCAAAACCCAAGAATCGATCTCATCTCA
TAACCCAAGCAAAAAAAGATCAAATTTTTACCCTTATTTTCCaAGATTTTGCTACCCCTTTGCCTCTTCACGAACAAGCCTTTTTTGtAT
TTCTCAGTTCAGTTTAGTTCTTCCCTCGTGCCGAATTCGGAAcGAGGTAGAAAGTTCACCTGCAGAAGCTGAAGTAGXAGCGGCGTTCAA
TTTTGCTACGAATCTCCTCAAAGGAGAGAGCAGTAAAGtAATTCAGTGAGGGAGGTAACTTGCTTGGTACAGCTGtAAAACATGAATCCA
AATGAATCTGCAAAGTCTCATGCCAAACCTGATATCATTCTGACTGGGACTGCAAAAACATGTCCAAATGGACCGCCACTTGGTTTGGTT
GACATAGGCAGTAGTGAGAATGCATACCTTTTTCGTGTTGCGCTTCCTGGTGTAAGGCATAAATGTAATATCAAATTTGACATACAAAGA
GAAGGGAGAGTCCGGATAGAAGGTGTGATTACAGAGAGTGAGGCTTTGAAAAACTCACTCAAGGGTTATGAGATGAAAGTTCAGCAGCTT
CCGTCCCCTGGGCCTTTTACCATATCGTTCAATTTGCCAGGACCTGTTGATCCCAGATTATGTTCCCCACAGTTTAGAACAGATGGCATT
TTGGAAGTCATTGTGATGAAATATCAGATACCATTGGTTTCAGCTGAAGGTTTGCCTGAGAATTGGTACAATGGCTCTTTCCCAGCTCCt
TGAATTCTATTTGGTCCACATTCCCCCCTATGACACATGGGAATTCTATTTGTTCAACAACTCTTGTAATGAATATAACACAGCATCAGG
AACACGACTTCTCAACTTCTAG\(3')GTAGCCATACCTGTACACCAAGGGTTTTTGCATTATATGCTCCACTCGAGATTTTGGTATTGT
TGACTTGATTTTGAATCAAGTGTGTACTTTTATGGGGAAAAAATACTTCTTTTCCATCTTTATTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan