ESTScan Details for Unigene SGN-U274053

Score 
502
Direction 
Forward
Predicted Peptide Sequence 
ATKIIYPKNKAFLLPATVSGENPRKLKSEDXPVFIHSVYEDYSSFYVLINSCESNWEQGXEAVRMGEVNYMREEDVKLDAVRARFSNVLK
RHSELAERLSRDSDKSIFDRLQKEFEAARASQTQELILKGEQWNDGLLATIRERVHMEAERKAVQMPGDTTQLPIPFHDKITYKVGNKVI
CCLDGARIGIQYDTSFAGESCDLYHCVLESKSFLEKMTVLEHTVPFFLPIREAENEFLSSNAKYDDYITCIRSSFNXVIASLLLDPSSFI
HSTDWVLXELGFMILQRFIDHVGDLLQAYVDRREQVRLIKELYGNQIGELYHSLPYHMIEFVIEDFDSKVTVSLRYADLISTLPTGVSVL
AWPMHQSKKSSDKIALHLKGNGVGSHPIPARLTYAEDALRTMSLPEAYAEIVLNLPQALQDXVSPHKLDIVVVIRDLL
Predicted Coding Sequence 
XXGGCAACTAAAATAATATACCCAAAGAACAAAGCCTTTTTACTTCCGGCCACCGTCTCCGGAGAAAATCCACGAAAGCTGAAATCGGAA
GACGAXCCGGTTTTTATTCATTCAGTTTATGAAGATTACAGTAGCTTCTATGTTTTAATCAACTCTTGTGAATCAAATTGGGAACAAGGA
GXTGAAGCTGTTAGAATGGGAGAAGTGAATTATATGCGAGAGGAGGATGTAAAGCTGGACGCTGTACGGGCTAGATTTTCAAATGTTCTT
AAAAGACATTCGGAGCTAGCAGAGCGTCTTTCTAGGGATTCTGATAAGTCGATTTTTGATCGTCTACAAAAGGAATTTGAAGCCGCACGT
GCTTCTCAAACTCAAGAACTCATCTTAAAAGGTGAGCAATGGAATGATGGCTTATTGGCAACAATAAGAGAGCGGGTACACATGGAGGCT
GAGAGAAAGGCTGTGCAAATGCCAGGGGATACAACCCAGTTGCCAATTCCATTTCATGATAAAATTACCTACAAAGTTGGGAATAAGGTT
ATTTGTTGCTTGGATGGAGCAAGGATAGGCATACAATATGATACTTCATTTGCAGGCGAATCTTGTGACCTATACCACTGTGTGCTTGAG
AGCAAGTCATTTCTGGAGAAGATGACTGTTCTGGAACATACAGTTCCTTTTTTCTTGCCAATACGTGAAGCTGAAAACGAGTTTCTCTCG
TCAAATGCAAAGTATGATGACTACATCACTTGTATTAGATCCTCTTTTAATXATGTCATTGCTTCATTGTTATTAGATCCTAGCTCTTTC
ATACATAGTACTGACTGGGTACTTXCTGAACTTGGATTCATGATTCTTCAGAGATTTATTGATCATGTTGGAGATCTGTTGCAAGCCTAT
GTAGATAGACGGGAACAGGTTCGGCTTATTAAAGAGTTGTATGGAAATCAAATTGGTGAACTCTATCATAGTCTTCCATACCATATGATC
GAGTTTGTGATTGAAGATTTTGATTCCAAGGTGACAGTGAGTCTGAGATATGCAGATCTGATCTCTACACTTCCCACTGGGGTTAGTGTC
CTGGCATGGCCTATGCACCAATCGAAGAAATCTTCTGATAAAATTGCCCTGCATCTGAAAGGAAATGGAGTTGGAAGTCACCCTATCCCA
GCGCGTTTGACGTATGCAGAGGATGCACTCCGAACCATGAGTCTGCCAGAAGCATATGCAGAAATTGTCTTGAATCTTCCTCAAGCTCTG
CAGGACAXTGTTTCCCCACACAAGCTCGACATAGTTGTAGTTATTCGTGACCTGTTGTAG\
Edits in Original Sequence 
(5')XXGGCAACTAAAATAATATACCCAAAGAACAAAGCCTTTTTACTTCCGGCCACCGTCaTCCGGAGAAAATCCACGAAAGCTGAAAT
CGGAAGACGAXCCGGTTTTTATTCATTCAGTTTATGAAGATTACAGTAGCTTCTATGTTTTAATCAACTCTTGTGAATCAAATTGGGAAC
AAGGAGXTGAAGCTGTTAGAATGGGAGAAGTGAATTATATGCGAGAGGAGGATGTAAAGCTGGACGCTGTACGGGCTAGATTTTCAAATG
TTCTTAAAAGACATTCGGAGCTAGCAGAGCGTCTTTCTAGGGATTCTGATAAGTCGATTTTTGATCGTCTACAAAAGGAATTTGAAGCCG
CACGTGCTTCTCAAACTCAAGAACTCATCTTAAAAGGTGAGCAATGGAATGATGGCTTATTGGCAACAATAAGAGAGCGGGTACACATGG
AGGCTGAGAGAAAGGCTGTGCAAATGCCAGGGGATACAACCCAGTTGCCAATTCCATTTCATGATAAAATTACCTACAAAGTTGGGAATA
AGGTTATTTGTTGCTTGGATGGAGCAAGGATAGGCATACAATATGATACTTCATTTGCAGGCGAATCTTGTGACCTATACCACTGTGTGC
TTGAGAGCAAGTCATTTCTGGAGAAGATGACTGTTCTGGAACATACAGTTCCTTTTTTCTTGCCAATACGTGAAGCTGAAAACGAGTTTC
TCTCGTCAAATGCAAtAGTATGATGACTACATCACTTGTATTAGATCCTCTTTTAATXATGTCATTGCTTCATTGTTATTAGATCCTAGC
TCTTTCATACATAGTACTGACTGGGTACTTXCTGAACTTGGATTCATGAtTTCTTCAGAGATTTATTGATCATGTTGGAGATCTGTTGCA
AGCCTATGTAGATAGACGGGAACAGGTTCGGCTTATTAAAGAGTTGTATGGAAATCAAATTGGTGAACTCTATCATAGTCTTCCATACCA
TATGATCGAGTTTGTGATTGAAGATTTTGATTCCAAGGTGACAGTGAGTCTGAGATATGCAGATCTGATCTCTACACTTCCCACTGGGGT
TAGTGTCCTGGCATGGCCTATGCACCAATCGAAGAAATCTTCTGATAAAATTGCCCTGCATCTGAAAGGAAATGGAGTTGGAAGTCACCC
TATCCCAGCGCGTTTGACGTATGCAGAGGATGCACTCCGAACCATGAGTCTGCCAGAAGCATATGCAGAAATTGTCTTGAATCTTCCTCA
AGCTCTGCAGGACAXTGTTTCCCCACACAAGCTCGACATAGTTGTAGTTATTCGTGACCTGTTGTAG\(3')CGCCTTGTTGCATGCTGT
GTAGCGAATGCTCTGGTTGTAAACTGAATGTTTTTCCCCTTTATACATGTATAGTCTGAAAATCCAGTGTAGTGAGGCGTGAACGCCTTC
TTTTTGGCAACTCTTAAACTTAGTTCAGGAAAATTTGCCTTTGTTATCTGTTCTAACGATTATGTTTTTGGGGAAGAAATGGAATAGAAT
TTACAATCATCACAAAAAAAAAAAAAAAAAAAAAAAAACAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan