ESTScan Details for Unigene SGN-U274073

Score 
975
Direction 
Forward
Predicted Peptide Sequence 
LGFSADRDYSKTLAQNPRTNQKEPMAYQQHQSPNHTGDNDDGKNRRLYNPYQDLQVPIKTLYKLPTSPEFLFQEESVAQRRSWGENLTYY
TGIGYLSGAVVGAGKGFVEGVKASEPGDTTKLRINRILNASGHTGRKFGNRAGVIGLLYAGMESGMVAIRDTDDVINSVVAGLGTGAFYR
AASGLRSAAVAGVIGGVVVGLGVTGKQALKRYVPSKICAGXAFGFMTSILVAVICFKNFDNTLRNCVLALPSNVIWHESFMLSRYILTIL
LNIYSETRFRGDFLLNKVXKKLNLDMIASLLILSIYVLTDFAEDESLSPCGSGGVPEKGCSRIKAAACSKEDARMSRDYEISAGPLSRRS
AIISGASLISSVLLFPGEGSAVIKQGLLAGRVPGLSEPDEEGRLEDIPKTGDKSGGHGVGWSPMIPYTFSVPDKWEEVPVSIADLGGTEI
DLRFANPKEGRVIVIVAPVKRFSDEIGEEATIEQIGPPDKVISAFGPEVIGENVEGKVLRSEVAEHEGRTYYQFELEPPHVMITATAAGN
RLYLFNVTGNGLQWKRYYKDLRKIAESFRVV
Predicted Coding Sequence 
CTTGGGTTCTCTGCXGATCGGGATTATAGCAAAACCCTAGCTCAAAACCCTAGAACAAACCAGAAGGAGCCCATGGCGTATCAACAACAC
CAATCACCTAATCACACCGGAGACAACGACGACGGAAAGAATCGCCGGCTCTATAACCCTTACCAAGACCTACAAGTTCCAATCAAAACA
CTTTACAAGCTTCCTACCTCGCCTGAGTTTCTGTTTCAGGAAGAATCTGTTGCTCAGCGTAGATCATGGGGAGAGAATTTAACGTACTAC
ACTGGTATCGGTTATCTCTCTGGTGCTGTTGTCGGTGCCGGTAAAGGATTTGTTGAAGGTGTGAAAGCTTCAGAGCCAGGTGATACTACG
AAGCTCAGGATCAATAGAATCCTGAATGCGTCGGGTCATACAGGCCGGAAGTTTGGAAATCGAGCTGGTGTTATTGGGTTGCTTTATGCT
GGGATGGAGAGTGGAATGGTTGCTATTAGGGATACGGATGATGTTATCAACAGCGTGGTTGCTGGCTTGGGGACTGGTGCGTTCTACAGG
GCGGCTTCGGGGCTAAGGTCAGCTGCCGTGGCTGGAGTTATTGGCGGCGTCGTTGTTGGCTTGGGGGTAACTGGAAAACAGGCGCTAAAA
CGATATGTCCCATCTAAGATTTGTGCTGGTXTTGCTTTTGGATTTATGACCTCAATCTTGGTAGCTGTTATTTGTTTCAAAAATTTTGAT
AATACCTTGAGAAATTGTGTTCTCGCACTGCCCAGTAATGTAATTTGGCATGAAAGTTTCATGCTTTCTAGATATATTTTAACAATTTTA
TTGAATATATATTCTGAAACTAGGTTTAGAGGAGATTTTCTCTTGAATAAGGTTGAXAAGAAACTGAATCTTGATATGATTGCTTCATTA
CTTATTTTGTCCATCTATGTGTTGACAGATTTTGCAGAGGATGAATCCCTCTCACCATGTGGTTCCGGTGGTGTTCCAGAAAAAGGGTGT
TCAAGAATTAAAGCTGCTGCTTGTTCTAAAGAAGATGCTCGTATGAGCCGGGATTATGAGATATCTGCAGGCCCATTGAGTAGGAGGTCA
GCTATTATATCTGGTGCTTCCTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAACAAGGTCTCCTAGCAGGG
AGAGTTCCTGGACTGTCTGAACCAGATGAAGAAGGCAGGTTGGAGGACATACCGAAGACCGGTGACAAGTCAGGTGGACATGGTGTTGGA
TGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTAGGTGGTACAGAGATC
GACTTGAGATTCGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTCGCTCCTGTAAAAAGATTTTCAGATGAAATTGGTGAAGAAGCT
ACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAAGGTAAAGTCTTGAGA
TCTGAAGTCGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTAATGATCACAGCAACAGCTGCTGGAAAT
CGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCTGAGTCTTTCAGGGTT
GTGTAA\
Edits in Original Sequence 
(5')CTTGGGTTCTCTGCXGATCGGGATTATAGCAAAACCCTAGCTCAAAACCCTAGAACAAACCAgGAAGGAGCCCATGGCGTATCAAC
AACACCAATCACCTAATCACACCGGAGACAACGACGACGGAAAGAATCGCCGGCTCTATAACCCTTACCAAGACCTACAAGTTCCAATCA
AAACACTTTACAAGCTTCCTACCTCGCCTGAGTTTCTGTTTCAGGAAGAATCTGTTGCTCAGCGTAGATCATGGGGAGAGAATTTAACGT
ACTACACTGGTATCGGTTATCTCTCTGGTGCTGTTGTCGGTGCCGGTAAAGGATTTGTTGAAGGTGTGAAAGCTTCAGAGCCAGGTGATA
CTACGAAGCTCAGGATCAATAGAATCCTGAATGCGTCGGGTCATACAGGCCGGAAGTTTGGAAATCGAGCTGGTGTTATTGGGTTGCTTT
ATGCTGGGATGGAGAGTGGAATGGTTGCTATTAGGGATACGGATGATGTTATCAACAGCGTGGTTGCTGGCTTGGGGACTGGTGCGTTCT
ACAGGGCGGCTTCGGGGCTAAGGTCAGCTGCCGTGGCTGGAGTTATTGGCGGCGTCGTTGTTGGCTTGGGGGTAACTGGAAAACAGGCGC
TAAAACGATATGTCCCgATCTAAGATTTGTGCTGGTXTTGCTTTTGGATTTATGACCTCAATCTTGGTAGCTGTTATTTGTTTCAAAAAT
TTTGATAATACCTTGAGAAATTGTGTTCTCGCACTGCCCAGTAATGTAATTTGGCATGAAAGTTTCATGCTTTCTAGATATATTTTAACA
ATTTTATTGAATATATATTCTGAAACTAGGTTTAGAGGAGATTTTCTCTTGAATAAGGTTGAXAAGAAACTGAATCTTGATATGATTGCT
TCATTACTTATTTTGTCCATCTATGTGTTGACAGATTTTGCAGAcGGATGAATCCCTCTCACCATGTGGTTCCGcGTGGTGTTCCAGAAA
AAGGGTGTTCAAGAATTAAAGCTGCTGCTTGTTCTAAAGAAGATGCTCGTATGAGCCGGGATTATGAGATATCTGCAGGCCCATTGAGTA
GGAGGTCAGCTATTATATCTGGTGCTTCCTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAACAAGGTCTCC
TAGCAGGGAGAGTTCCTGGACTGTCTGAACCAGATGAAGAAGGCAGGTTGGAGGACATACCGAAGACCGGaTGACAAGTCAGGTGGACAT
GGTGTTGGATGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTAGGTGGT
ACAGAGATCGACTTGAGATTCGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTCGCTCCTGTAAAAAGATTTTCAGATGAAATTGGT
GAAGAAGCTACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAAGGTAAA
GTCTTGAGATCTGAAGTCGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTAATGATCACAGCAACAGCT
GCTGGAAATCGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCTGAGTCT
TTCAGGGTTGTGTAA\(3')TTTACACATCTACCCCATGCGTGATAGCACCTTAGCAGAGGTGGAATGCACAAGGAAGAAGAGTCAGTCA
GTATAATCATATTTACAAGAAGCCACATCACCTCTAGTAGTATATACAGTTAAATATGTGAGAGGAGAATTTCCTCTAGAATGAGTTTTG
TAACAAATTTTAGCTACCAATGATTATTGTAAACTGTTTACGTTACTAATATTACAAGTCTTCAGAAGGCACCTCTTCTGGATTGATCGC
GAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan