ESTScan Details for Unigene SGN-U274093

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
VRSGVPESEATAAFQELVNAYEVLSDARERAWYDSHRSQILFSNSGPGNSSNSGSIPDLFSFFSNSVYSGYSDKGKGFYKVYGDLFEKIY
QHDLNFARKLGTDLPKEAPLMGNLESPYAQVTAFYSYWLGFVTVMDFCWADQYDVMAGPNRKSRRVMEDENKKLRKKARREYNETVRGLA
EFVKKRDKRVIDMQMKRNEEMEKKKEEEXQEKEGAGEKKAEEQETTVEPEWTKAEIRNDGIEEESDEDEKEKADENELYCVVCSKKFKSE
Predicted Coding Sequence 
GTTCGATCCGGCGTGCCGGAATCCGAAGCAACAGCTGCATTCCAGGAGCTTGTGAATGCCTACGAAGTTTTGTCGGATGCACGGGAGCGC
GCTTGGTACGATTCACACCGTTCTCAGATACTCTTCTCTAATTCCGGTCCAGGGAATTCGTCTAACTCTGGTTCTATCCCCGACCTGTTC
TCCTTCTTTTCAAATTCAGTGTATTCTGGATATTCAGATAAAGGGAAGGGATTTTACAAGGTGTATGGTGATCTCTTCGAGAAAATCTAC
CAACACGATTTAAATTTCGCGAGGAAGTTAGGTACAGATTTGCCAAAAGAAGCTCCTCTCATGGGAAATTTGGAGAGTCCTTATGCTCAA
GTGACTGCATTCTATAGCTATTGGTTAGGATTCGTTACTGTGATGGACTTTTGTTGGGCAGATCAGTATGACGTGATGGCAGGACCTAAT
AGAAAGTCCAGGCGGGTGATGGAGGATGAGAACAAGAAGCTGAGGAAAAAGGCGCGAAGGGAATACAATGAGACTGTTAGAGGATTAGCA
GAGTTTGTGAAAAAGAGAGATAAGAGAGTGATTGACATGCAGATGAAGAGGAACGAGGAAATGGAGAAGAAAAAGGAAGAGGAACXGCAA
GAGAAGGAAGGAGCTGGAGAGAAGAAGGCTGAAGAGCAAGAAACTACXGTAGAGCCTGAGTGGACGAAAGCAGAGATTAGAAATGATGGA
ATTGAGGAGGAATCGGACGAAGACGAGAAAGAGAAGGCAGATGAGAATGAATTGTACTGTGTGGTGTGTTCGAAGAAGTTCAAGAGCGAG
\
Edits in Original Sequence 
(5')GTTCGATCCGGCGTGCCGGAATCCGAAGCAACAGCTGCATTCCAGGAGCTTGTGAATGCCTACGAAGTTTTGTCGGATGCACGGGA
GCGCGCTTGGTACGATTCACACCGTTCTCAGATACTCTTCTCTAATTCCGGTCCAGGGAATTCGTCTAACTCTGGTTCTATCCCCGACCT
GTTCTCCTTCTTTTCAAATTCAGTGTATTCTGGATATTCAGATAAAGGGAAGGGATTTTACAAGGTGTATGGTGATCTCTTCGAGAAAAT
CTACCAACACGATTTAAATTTCGCGAGGAAGTTAGGTACAGATTTGCCAAAAGAAGCTCCTCTCATGGGAAATTTGGAGAGTCCTTATGC
TCAAGTGACTGCATTCTATAGCTATTGGTTAGGATTCGTTACTGTGATGGACTTTTGTTGGGCAGATCAGTATGACGTGATGGCAGGACC
TAATAGAAAGTCCAGGCGGGTGATGGAGGATGAGAACAAGAAGCTGAGGAAAAAGGCGCGAAGGGAATACAATGAGACTGTTAGAGGATT
AGCAGAGTTTGTGAAAAAGAGAGATAAGAGAGTGATTGACATGCAGATGAAGAGGAACGAGGAAATGGAGAAGAAAAAGGAAGAGGAACX
GCAAGAGAAGGAAGGAGCTGGAGAGAAGAAGGCTGAAGAGCAAGAAACTACXGTAGAGCCTGAGTGGACGAAAGCAGAGATTAGAAATGA
TGGAATTGAGGAGGAATCGGACGAAGACGAGAAAGAGAAGGCAGATGAGAATGAATTGTACTGTGTGGTGTGTTCGAAGAAGTTCAAGAG
CGAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan