ESTScan Details for Unigene SGN-U274108

Score 
577
Direction 
Forward
Predicted Peptide Sequence 
QTLVVTTLPVVRGGDSMXLPIPVTGGSVLYSAASQSTGYTNHTVGGSDGWFFDINTQKASADYSAWAAKQTFNLGDTLVFNTNTNQTVIQ
TYNATTYRNCTADYASDDDTFQYQGGSNEFGEAMTVTVSLTLEGQQYYFSDADDGSQCLNGMAFDIKVRHGIGLPPSLNQPPPPPYVEPP
STVEDAESPPITVVTSSPNGGVRSSARLFLAVFVLXNVGVAFGLRWKTILPSSKTDLKVGAIHIFIA
Predicted Coding Sequence 
XGTCAAACGTTAGTAGTAACAACTCTGCCCGTTGTTCGCGGTGGTGACTCCATGGXTCTTCCTATTCCTGTTACCGGTGGCTCTGTTCTT
TACTCGGCAGCTTCACAGTCAACCGGATATACAAACCATACTGTTGGTGGTTCAGATGGTTGGTTCTTTGACATCAACACTCAAAAGGCT
TCTGCTGATTACTCTGCTTGGGCTGCTAAACAGACCTTTAATCTTGGTGACACTTTGGTGTTTAATACAAACACCAACCAGACAGTTATT
CAAACATACAATGCAACCACATATAGGAACTGCACCGCGGATTATGCTTCAGATGATGACACATTTCAGTATCAAGGAGGCAGCAATGAA
TTTGGTGAAGCGATGACAGTCACTGTTTCATTGACCCTCGAGGGCCAACAATACTATTTCTCTGATGCTGATGATGGGAGTCAGTGCCTG
AATGGCATGGCATTCGATATCAAAGTGAGGCATGGTATAGGACTTCCTCCGAGCCTCAACCAACCACCTCCTCCACCCTATGTGGAACCA
CCATCCACAGTCGAAGATGCTGAGTCACCGCCTATCACCGTGGTAACCAGCAGCCCTAACGGTGGTGTGAGGAGCAGTGCTAGACTCTTC
TTGGCGGTTTTTGTACTTGXTAATGTTGGTGTTGCATTTGGTCTAAGGTGGAAAACTATACTTCCTAGTTCCAAGACAGATTTGAAAGTT
GGAGCTATCCATATATTTATTGCTTAG\
Edits in Original Sequence 
(5')XGTCAAACGTTAGTAGTAACAACTCTGCCCGTTGTTCGCGGTGGtTGACTCCATGGXTCTTCCTATTCCTGTTACCGGTGGCTCTG
TTCTTTaACTCGGCAGCTTCACAGTCAACCGGATATACAAACCATACTGTTGGTGGTTCAGATGGTTGGTTCTTTGACATCAACACTCAA
AAGGCTTCTGCTGATTACTCTGCTTGGGCTGCTAAACAGACCTTTAATCTTGGTGACACTTTGGTGTTTAATACAAACACCAACCAGACA
GTTATTCAAACATACAATGCAACCACATATAGGAACTGCACCGCGGATTATGCTTCAGATGATGACACATTTCAGTATCAAGGAGGCAGC
AATGAATTTGGTGAAGCGATGACAGTCACTGTTTCATTGACCCTCGAGGGCCAACAATACTATTTCTCTGATGCTGATGATGGGAGTCAG
TGCCTGAATGGCATGGCATTCGATATCAAAGTGAGGCATGGTATAGGACTTCCTCCGAGCCTCAACCAACCACCTCCTCCACCCTATGTG
GAACCACCATCCACAGTCGAAGATGCTGAGTCACCGCCTATCACCGTGGTAACCAGCAGCCCTAACGGTGGTGTGAGGAGCAGTGCTAGA
CTCTTCTTGGCGGTTTTTGTACTTGXTAATGTTGGTGTTGCATTTGGTCTAAGGTGGAAAACTATACTTCCTAGTTCCAAGACAGATTTG
AAAGTTGGAGCTATCCATATATTTATTGCTTAG\(3')AAATGAGAGAAAGAAAAGGAGTTAATTCAAATTATTACAGGTTTTTGTATTG
TAGCATATTTATCTATCACATTTTTCATTCAATTGTCCAGTATTTACCACAGGCCGTTACATGGAGAAATCTATTGAGATAATTTTTTAT
CCAATTTTTGATTGATGGGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan