ESTScan Details for Unigene SGN-U274118

Score 
1093
Direction 
Forward
Predicted Peptide Sequence 
MGEKKEETKAEVAEKKNDAGEKKSGAGDAAGKKDAGPTAIVLKLDLHCEGCAKKVKRFIRHFEGVEDVKTDCDGGKLTVKGNVDXGMAPG
ESSDEDEEDGGARLPQPKKDAGAGDKKPDEKKAEEKKPEDKKPKEPQVSTVVLKIRLHCDGCAHKIKRIIKKIDGVEEVKVDSEKDLVTV
KGTMDLKKLIPYLKDKLKRNVEIVPPKKDDGGGEKKEGGGEKKEKEGGGGVKKEKEGGGGEKKEKEGGGDKKVESNKKKEGEPKAEGSKG
VETKSEANRLEYYGX
Predicted Coding Sequence 
ATGGGTGAGAAAAAAGAAGAAACTAAAGCAGAGGTAGCAGAGAAGAAGAATGACGCCGGAGAAAAAAAGTCCGGCGCCGGTGACGCCGCC
GGGAAAAAGGATGCCGGTCCCACCGCCATAGTTTTAAAACTCGATTTGCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTTCATTCGC
CATTTCGAAGGTGTGGAGGATGTGAAGACAGATTGTGACGGTGGAAAATTGACGGTGAAAGGGAACGTGGACXCCGGCATGGCTCCGGGA
GAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTCGTCTTCCTCAGCCCAAAAAGGACGCCGGCGCCGGGGATAAAAAGCCCGATGAG
AAAAAGGCAGAAGAGAAAAAACCCGAAGATAAGAAGCCCAAAGAGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGAT
GGATGTGCACACAAAATAAAGAGAATTATAAAGAAAATTGATGGGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCACGGTA
AAGGGTACGATGGACTTAAAGAAATTAATTCCCTATTTGAAAGATAAACTGAAAAGAAATGTAGAAATTGTCCCACCTAAGAAAGATGAT
GGAGGTGGCGAAAAGAAAGAAGGTGGTGGAGAGAAGAAAGAGAAAGAAGGCGGCGGTGGTGTGAAGAAAGAGAAAGAAGGTGGTGGTGGT
GAGAAGAAAGAGAAAGAAGGGGGCGGTGATAAGAAGGTCGAGAGTAATAAGAAAAAAGAGGGTGAACCAAAAGCCGAAGGAAGTAAAGGT
GTGGAGACAAAGTCTGAAGCGAACAGATTAGAGTATTATGGTCAX\
Edits in Original Sequence 
TTCATTCTATAATTTCGTCTATAATCCATTTTCATTTTTCAA(5')ATGGGTGAGAAAAAAGAAGAAACTAAAGCAGAGGTAGCAGAGAA
GAAGAATGACGCCGGAGAAAAAAAGTCCGGCGCCGGTGACGCCGCCGGGAAAAAGGATGCCGGTCCCACCGCCATAGTTTTAAAACTCGA
TTTGCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTTCATTCGCCATTTCGAAGGTGTGGAGGATGTGAAGACAGATTGTGACGGTGG
AAAATTGACGGTGAAAGGGAACGTGGACXCCGGCATGGCTCCGGGAGAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTCGTCTcTC
CTCAGCCCAAAAAGGACGCCGGCGCCGGGGATAAAAAGCCCGATGAGAAAAAGGCAGAAGAGAAAAAACCCGAAGATAAGAAGCCCAAAG
AGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGATGGATGTGCACACAAAATAAAGAGAATTATAAAGAAAATTGATG
GGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCACGGTAAAGGGTACGATGGACTTAAAGAAATTAATTCCCTATTTGAAAG
ATAAACTGAAAAGAAATGTAGAAATTGTCCCACCTAAGAAAGATGATGGAGGTGGCGAAAAGAAAGAAGGTGGTGGAGAGAAGAAAGAGA
AAGAAGGCGGCGGTGGTGTGAAGAAAGAGAAAGAAGGTGGTGGTGGTGAGAAGAAAGAGAAAGAAGGGGGCGGTGATAAGAAGGTCGAGA
GTAATAAGAAAAAAGAGGGTGAACCAAAAGCCGAAGGAAGTAAAGGTGTGGAGACAAAGTCTGAAGCGAACAGATTAGAGTATTATGGTC
AX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan