ESTScan Details for Unigene SGN-U274120

Score 
84
Direction 
Forward
Predicted Peptide Sequence 
KKPQNSAAMAWRGSVTRSLTSVARASTSRSSPPLTAFALLRSPPLVPTRAASHLPVPGPWELWGXTQSFLPLHNVVAGTRLTSHLTVNCG
LAAAVSWYLNTINGAAQSCLRFMVVLAG
Predicted Coding Sequence 
AAGAAACCACAGAATTCAGCAGCTATGGCTTGGCGTGGTTCCGTCACCAGATCACTCACTTCCGTCGCTAGAGCTTCCACTTCCCGTTCA
TCTCCGCCGTTAACCGCGTTCGCACTCCTCCGATCTCCGCCCCTCGTTCCAACACGCGCCGCTTCTCATTTACCAGTCCCAGGACCTTGG
GAGCTTTGGGGTGXTACTCAGTCATTTTTGCCGCTGCATAATGTGGTGGCTGGAACTCGATTGACTTCTCACTTGACAGTTAACTGCGGG
CTTGCTGCAGCTGTATCATGGTACTTGAACACAATTAATGGAGCAGCGCAAAGTTGCTTGAGGTTTATGGTAGTCTTGGCAGGTTGA\
Edits in Original Sequence 
(5')AAGAAACCACAGAATTCAGCAGCTATGGCTTGGCGTGGTTCCGTCACCAGATCACTCACTTCCGTCGCTAGAGCTTCCACTTCCCG
TTCATCTCCGaCCGTTAACCGCGTTCGCACTCCTCCGATCTCCGCCCCTCGTTCCAACACGCGCCGCTTCTCATTTACCAGTCCCAGGAC
CTTGGGAGCTTTGGGGTGXTACTCAGTCATTTTTGCCGCTGCATAATGTGGTGGCTGGAACTCGATTGACTTCTCACTTGACAGTTAACg
TGCGGGCTTGCTGCgAGCTGTATCATGGTACTTGAACACAATTAATGGAGCAGCGCAAAGTTGCTTGAGGTTTATGGTAGTCTTGGCAGG
TTGA\(3')TGCATCTCCGACAATCTGTTTTGGATGCAGAAAATAATAACTGTAATCTTTGTTTTTTCACATTCTAAAGATAAACTAGAA
AATCTGTTTCCGGCAGTATCATAGAGATTAAATTTATTTCAGTTAAGTGTTCATTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan