Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U274202

Score 
1744
Direction 
Forward
Predicted Peptide Sequence 
RKEKMAEQLDSVNARYVVEFDMKEVENSLRKDVVEKTRETQGTRALWISKRWWRYRPKLPYIYFLQKLDTSEVAAIVFTEDLKRVFVTMK
EGFPLEYIVDIPLDPFLFEMISSSGAEVDLLQKRQIHYFFKVLFALLPGILILWFIRESMMLLNITTNRLLYKKYKQLFDMAYAENFIXV
GEVGETKSMYKEIVLGGDVWDLLDELMIYMGNPMQYYEKDVKFVRGVLLSGPPGTGKTLFARTLAKESGMPFVFASGAEFTDSEKSGAAR
INEMFSVARRNAPAFVFIDEIDAIAGRHARKDPRRKATFEALISQLDGEKEKTGVDRFSLRQAVIFICATNRPDELDLEFVRPGRIDRRV
YIGLPDAKQRVQIFGVHSAGKQLSEDIAFEKLVFRTVGYSGADIRNLVNEAGIMSVRKGHSKINQQDIVDVLDKQLLEGMGVLLTEEEQQ
KCEQSVSREKRQLLAVHEAGHIVLAHLFPQFDWHAFSQLLPGGKETAVSVFYPREDVVDQGYTTFGYMKMQMVVAHGGRCAERIVFGDDI
TDGGVDDLEKITKIAREMVISPRNSRLGLTSLTKKIGLGDLPDSPDGEIIKYKWDDPHIIPADMTVEVAELFTRELTRYIDETEELAMRG
LLANRHILDLISNELLEHSRITGLEVEDKMRGLRPAMFEDFVKPFQINMEEEGPLPHNDRLSYNRWTFIPRPSTEVNINGGCXEFSSQID
IGSCQVMNVEVXEIMSFFTSTLTNTFANQQKACLVDS
Predicted Coding Sequence 
AGGAAGGAGAAGATGGCAGAACAATTAGATTCAGTAAATGCGAGGTATGTGGTTGAATTTGACATGAAGGAAGTTGAGAACAGCCTTCGC
AAAGATGTGGTTGAGAAGACAAGAGAAACTCAAGGAACCAGGGCATTGTGGATCTCGAAAAGATGGTGGAGATATCGCCCGAAACTTCCC
TATATCTATTTTCTTCAAAAACTTGATACTTCTGAGGTGGCTGCTATAGTCTTCACAGAGGATCTGAAGAGAGTGTTTGTCACAATGAAA
GAAGGATTCCCTCTTGAATATATTGTTGATATTCCACTAGATCCTTTCTTATTTGAGATGATATCAAGTTCTGGAGCTGAAGTAGATCTA
CTTCAGAAGCGGCAGATTCACTACTTTTTCAAAGTTCTTTTTGCTTTATTGCCTGGAATACTGATTTTGTGGTTTATAAGAGAATCTATG
ATGCTTCTGAACATCACGACAAATCGCCTCCTCTATAAGAAATATAAACAACTCTTCGATATGGCTTATGCTGAAAATTTTATTXTTGTT
GGAGAAGTTGGTGAGACGAAATCGATGTATAAAGAAATAGTATTGGGAGGAGATGTTTGGGATCTTTTGGATGAATTGATGATTTATATG
GGAAATCCAATGCAGTATTATGAGAAAGATGTCAAATTTGTGCGGGGTGTGCTTCTGTCTGGCCCCCCTGGAACAGGTAAAACACTGTTT
GCTCGGACACTTGCAAAGGAAAGTGGGATGCCTTTTGTATTTGCTTCTGGTGCAGAGTTTACTGATAGTGAAAAGAGTGGTGCTGCACGA
ATCAATGAAATGTTTTCTGTTGCTAGGAGAAATGCTCCAGCTTTTGTATTTATAGATGAGATTGATGCTATTGCTGGAAGGCATGCAAGA
AAGGATCCACGCAGGAAGGCAACATTTGAGGCTCTGATTTCTCAGCTTGACGGGGAGAAAGAAAAAACTGGTGTTGATAGGTTTTCACTA
AGACAAGCTGTCATATTCATCTGTGCAACCAATCGGCCAGATGAACTGGACTTAGAATTTGTCCGCCCTGGACGTATTGACAGACGTGTG
TATATTGGTTTACCAGATGCAAAGCAACGAGTGCAAATTTTTGGAGTTCACAGTGCTGGGAAACAGCTTTCCGAGGATATTGCCTTTGAG
AAACTTGTCTTTCGTACAGTTGGATATTCTGGGGCAGACATAAGAAATCTAGTCAATGAAGCTGGAATAATGTCTGTAAGAAAAGGACAT
TCTAAGATCAACCAGCAGGATATCGTCGATGTTTTGGACAAGCAATTGCTTGAGGGTATGGGTGTTCTCCTGACAGAGGAAGAGCAGCAG
AAGTGTGAGCAAAGTGTATCTCGTGAAAAAAGACAATTGTTGGCAGTACATGAAGCTGGTCACATTGTGTTGGCGCACTTGTTCCCTCAG
TTTGATTGGCATGCTTTTTCTCAGCTTCTACCTGGGGGAAAGGAAACTGCAGTATCAGTTTTCTACCCTAGAGAAGATGTGGTTGATCAA
GGTTATACAACCTTTGGCTACATGAAAATGCAAATGGTAGTAGCTCATGGCGGGCGCTGTGCCGAACGTATTGTATTTGGTGATGACATT
ACTGATGGAGGAGTAGATGATCTAGAAAAGATTACCAAGATTGCTCGGGAAATGGTGATAAGTCCTAGAAACTCTAGGTTGGGCCTCACT
TCTTTGACAAAAAAAATAGGATTGGGTGATCTGCCTGACAGTCCTGATGGTGAGATTATAAAATATAAGTGGGATGATCCTCATATAATT
CCTGCTGATATGACAGTTGAAGTTGCTGAGCTATTTACTCGTGAATTGACAAGGTATATTGATGAGACGGAGGAACTTGCAATGAGGGGG
TTATTGGCCAACAGGCATATACTGGATTTGATTTCCAATGAGCTTCTTGAACACTCAAGAATAACTGGATTGGAAGTAGAAGACAAAATG
AGAGGGTTACGGCCTGCCATGTTTGAAGATTTTGTGAAGCCTTTCCAAATAAACATGGAGGAGGAAGGACCATTGCCTCATAATGACCGT
TTGAGTTACAACCGCTGGACATTTATCCCGCGCCCCTCCACAGAAGTTAACATCAATGGTGGTTGTXATGAGTTTTCTAGTCAGATCGAC
ATCGGAAGTTGCCAAGTAATGAATGTTGAGGTGXTAGAGATAATGTCCTTTTTCACATCAACTCTGACCAATACCTTTGCAAACCAACAG
AAAGCGTGCTTAGTAGATAGTTAG\
Edits in Original Sequence 
(5')AGGAAGGAGAAGATGGCAGAACAATTAGATTCAGTAAATGCGAGGTATGTGGTTGAATTTGACATGAAGGAAGTTGAGAACAGCCT
TCGCAAAGATGTGGTTGAGAAGACAAGAGAAACTCAAGGAACCAGGGCATTGTGGATCTCGAAAAGATGGTGGAGATATCGCCCGAAACT
TCCCTATATCTATTTTCTTCAAAAACTTGATACTTCTGAGGTGGCTGCTATAGTCTTCACAGAGGATCTGAAGAGAGTGTTTGTCACAAT
GAAAGAAGGATTCCCTCTTGAATATATTGTTGATATTCCACTAGATCCTTTCTTATTTGAGATGATATCAAGTTCTGGAGCTGAAGTAGA
TCTACTTCAGAAGCGGCAGATTCACTACTTTTTCAAAGTTCTTTTTGCTTTATTGCCTGGAATACTGATTTTGTGGTTTATAAGAGAATC
TATGATGCTTCTGAACATCACGACAAATCGCCTCCTCTATAAGAAATATAAACAACTCTTCGATATGGCTTATGCTGAAAATTTTATTXT
TGTTGGAGAAGTTGGTGAGACGAAATCGATGTATAAAGAAATAGTATTGGGAGGAGATGTTTGGGATCTTTTGGATGAATTGATGATTTA
TATGGGAAATCCAATGCAGTATTATGAGAAAGATGTCAAATTTGTGCGGGGTGTGCTTCTGTCTGGCCCCCCTGGAACAGGTAAAACACT
GTTTGCTCGGACACTTGCAAAGGAAAGTGGGATGCCTTTTGTATTTGCTTCTGGTGCAGAGTTTACTGATAGTGAAAAGAGTGGTGCTGC
ACGAATCAATGAAATGTTTTCTGTTGCTAGGAGAAATGCTCCAGCTTTTGTATTTATAGATGAGATTGATGCTATTGCTGGAAGGCATGC
AAGAAAGGATCCACGCAGGAAGGCAACATTTGAGGCTCTGATTTCTCAGCTTGACGGGGAGAAAGAAAAAACTGGTGTTGATAGGTTTTC
ACTAAGACAAGCTGTCATATTCATCTGTGCAACCAATCGGCCAGATGAACTGGACTTAGAATTTGTCCGCCCTGGACGTATTGACAGACG
TGTGTATATTGGTTTACCAGATGCAAAGCAACGAGTGCAAATTTTTGGAGTTCACAGTGCTGGGAAACAGCTTTCCGAGGATATTGCCTT
TGAGAAACTTGTCTTTCGTACAGTTGGATATTCTGGGGCAGACATAAGAAATCTAGTCAATGAAGCTGGAATAATGTCTGTAAGAAAAGG
ACATTCTAAGATCAACCAGCAGGATATCGTCGATGTTTTGGACAAGCAATTGCTTGAGGGTATGGGTGTTCTCCTGACAGAGGAAGAGCA
GCAGAAGTGTGAGCAAAGTGTATCTCGTGAAAAAAGACAATTGTTGGCAGTACATGAAGCTGGTCACATTGTGTTGGCGCACTTGTTCCC
TCAGTTTGATTGGCATGCTTTTTCTCAGCTTCTACCTGGGGGAAAGGAAACTGCAGTATCAGTTTTCTACCCTAGAGAAGATGTGGTTGA
TCAAGGTTATACAACCTTTGGCTACATGAAAATGCAAATGGTAGTAGCTCATGGCGGGCGCTGTGCCGAACGTATTGTATTTGGTGATGA
CATTACTGATGGAGGAGTAGATGATCTAGAAAAGATTACCAAGATTGCTCGGGAAATGGTGATAAGTCCTAGAAACTCTAGGTTGGGCCT
CACTTCTTTGACAAAAAAAATAGGATTGGGTGATCTGCCTGACAGTCCTGATGGTGAGATTATAAAATATAAGTGGGATGATCCTCATAT
AATTCCTGCTGATATGACAGTTGAAGTTGCTGAGCTATTTACTCGTGAATTGACAAGGTATATTGATGAGACGGAGGAACTTGCAATGAG
GGGGTTATTGGCCAACAGGCATATACTGGATTTGATTTCCAATGAGCTTCTTGAACACTCAAGAATAACTGGATTGGAAGTAGAAGACAA
AATGAGAGGGTTACGGCCTGCCATGTTTGAAGATTTTGTGAAGCCTTTCCAAATAAACATGGAGGAGGAAGGACCATTGCCTCATAATGA
CCGTTTGAGTTAtCAACCGCTGGACATTTATCCCGCGCCCCTCCACAGAAGTTAACATCAATGGTGGTTGTXATGAGTTTTCTAGTCAGA
TCGACATCGGAAGTTGCCAAGTAATGAATGTTGAGGTGXTAGAGATAATGTCCTTTTTCACATCAACTCTGACCAATACCTTTGCAAACC
AACAGAAAGCGTGCTTAGTAGATAGTTAG\(3')GTTGGGTTGCAATTGCTTCATCTTTTATTATTTTTCTTCTTTCCTTCTTTTGCTCT
CTTTTCTTTTCCCTTCAATTTATTTCATGGTCTATATAGAGGAACTTCGTACAAGAAAGACCAATGAGAATTCAGTATGTAAAATTTGGC
TATTTATTTATAAAATAAATTAATGTTAAGGAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan